DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng2

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001096418.1 Gene:cacng2 XenbaseID:XB-GENE-965516 Length:321 Species:Xenopus tropicalis

Alignment Length:233 Identity:62/234 (26%)
Similarity:96/234 (41%) Gaps:55/234 (24%)


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK----YTKSS 283
            |...|:|.|.|..:.:::..|:....||::         .|....|::.:.....|    .|.|.
 Frog     7 GVQMLLTTVGAFAAFSLMTIAVGTDYWLYS---------RGVCKSKSISENETSKKNEEVMTHSG 62

  Fly   284 LWILCT---TLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFL----AAGVF 340
            ||..|.   ...|:      |.:||:|..:. |:.|              :...||    |:.:|
 Frog    63 LWRTCCLEGNFKGV------CKQIDHFPEDADYEAD--------------TAEYFLRAVRASSIF 107

  Fly   341 LVISFI-VFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRS 398
            .::|.| :|:...|...:..|      ..||||.|:.:||..:||:|.|||   |..|...:..|
 Frog   108 PILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYIS---ANAGDPSKSDS 169

  Fly   399 TLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFIN 436
            ...    ..|||.||:.....||:.|.||||.:.:||:
 Frog   170 KKN----SYSYGWSFYFGALSFIIAEMVGVLAVHMFID 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 54/213 (25%)
cacng2NP_001096418.1 PMP22_Claudin 6..197 CDD:250157 60/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.