DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ogg1 and MAG1

DIOPT Version :9

Sequence 1:NP_572499.2 Gene:Ogg1 / 31806 FlyBaseID:FBgn0027864 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_011069.1 Gene:MAG1 / 856885 SGDID:S000000944 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:26/109 - (23%)
Similarity:44/109 - (40%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 AKFIAQTLQEIQKKGGQNWFISLKSMPFEKAREELTLLPGIGYKVADCICLMSMGHLE-SVPVDI 270
            |.:..:..::|:|..||      |....|.....:|.:.|||...|....:..:..:: ..|.|:
Yeast   152 AVYFTEKYKDIEKLFGQ------KDNDEEVIESLVTNVKGIGPWSAKMFLISGLKRMDVFAPEDL 210

  Fly   271 HIYRIAQNYYLPHLTGQKNVTKKIYEE--VSKHFQKLHGKYAGW 312
            .|.|....|    |:.:..:.|::..|  |.|..:..|.|| .|
Yeast   211 GIARGFSKY----LSDKPELEKELMRERKVVKKSKIKHKKY-NW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ogg1NP_572499.2 OGG_N 26..140 CDD:285211
ogg 33..324 CDD:211589 26/109 (24%)
ENDO3c 137..318 CDD:238013 26/109 (24%)
MAG1NP_011069.1 AlkA 1..291 CDD:223200 26/109 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0122
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.