DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32376 and CG15498

DIOPT Version :10

Sequence 1:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:77 Identity:17/77 - (22%)
Similarity:26/77 - (33%) Gaps:21/77 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DNGTHYLLYG--------KPED----IAPTPNFGNIS---SNPFINALEAQESFPTRIVNGK--- 70
            |....||.||        :|.|    :...|...|:|   ...|......:.:.|..:|:.|   
  Fly   131 DRTGQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCG 195

  Fly    71 ---RIPCTEAPF 79
               |:|.:...|
  Fly   196 PSARVPTSHTHF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 5/21 (24%)
CG15498NP_650974.1 None

Return to query results.
Submit another query.