DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32376 and Tmprss11g

DIOPT Version :10

Sequence 1:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:265 Identity:93/265 - (35%)
Similarity:131/265 - (49%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SNPFI---NALEAQE----------SFP--TRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINK 98
            |.|::   ||.:|:.          .:|  .||.:||.......|:|.||..||..:||..:|..
  Rat   154 SLPYLREMNAAQAEHILNSNCGLGMEYPRIARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGS 218

  Fly    99 IWILTAHHCF--FGPPEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDYTM-RH--DLAMMKLKS 158
            .|::|:.|||  :..|:.:||..|    |..|.....:|:.::..:.:|.. :|  |:|::||.|
  Rat   219 QWLVTSAHCFDNYKNPKLWTVSFG----RTLGNPLTTRKVESIIIHENYAAHKHDDDIAVVKLSS 279

  Fly   159 PVYFGKCVRPVKLPSTKTTKFPK-KFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKA 222
            ||.|.:.:|.|.||.......|| |..|:|||...||.. ....|:.|:|:.|....|.::....
  Rat   280 PVLFSENLRTVCLPEATFQVLPKSKVFVTGWGALKANGP-FPNSLQEVEIEIISNDVCNQVNVYG 343

  Fly   223 GLKIYKDMICAS-RTNK-DSCSGDSGGPLT-----SRGVLYGIVSWGIGCANKNYPGVYVNCKRY 280
            | .|...||||. .|.| |:|.|||||||.     ::..|.|||||||.|..:|.||:|.....|
  Rat   344 G-AISSGMICAGFLTGKLDACEGDSGGPLVISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHY 407

  Fly   281 VPWIK 285
            ..|||
  Rat   408 RNWIK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 84/231 (36%)
Tmprss11gNP_001008554.1 SEA 48..146 CDD:460188
Tryp_SPc 185..411 CDD:214473 84/231 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.