DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and hnrnpr

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_004911637.1 Gene:hnrnpr XenbaseID:XB-GENE-5726055 Length:536 Species:Xenopus tropicalis

Alignment Length:203 Identity:46/204 (23%)
Similarity:91/204 (45%) Gaps:35/204 (17%)


  Fly    15 TITITT--RKV---LDENLKSLLDEGKG-----ELFLSCIPRNHSCSPRWIVEVASELGEVYIMR 69
            |:.:||  ||.   ..|::.|....|.|     ::|:..|||:  .....:|.:..:.|.::.:|
 Frog    36 TLDVTTGQRKYGGPPPESVSSGAQPGIGTEVSVQVFVGKIPRD--LFEDELVPLFEKAGPIWDLR 98

  Fly    70 YKID-FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEP--------STNNRELVLKN 125
            ..:| .||.:||||::.:.|   ||:|.:.:     :||....:.|        |..|..|.:.:
 Frog    99 LMMDPLSGQNRGYAFITFCN---KEAAQEAV-----KLCDNYEIRPGKHIGVCISVANNRLFVGS 155

  Fly   126 VESSLRPWQVYQEMLKIHPFTIVRVYEYQLD-----QFFYIFEYRNNDSAASAHQRVRN-SIRKF 184
            :..:.....:.:|..|:....:..:..:|.|     :.|...||.::.:||.|.:|:.: .::.:
 Frog   156 IPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVW 220

  Fly   185 GEHAHISW 192
            |....:.|
 Frog   221 GNVVTVEW 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/93 (24%)
DUF3388 <127..169 CDD:288701 7/47 (15%)
hnrnprXP_004911637.1 hnRNP-R-Q 5..531 CDD:273732 46/204 (23%)
RRM_SF 69..145 CDD:302621 21/86 (24%)
RRM2_hnRNPR 147..231 CDD:240932 15/83 (18%)
RRM3_hnRNPR 243..314 CDD:240938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.