DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and dnd1

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001037899.1 Gene:dnd1 XenbaseID:XB-GENE-1015630 Length:373 Species:Xenopus tropicalis

Alignment Length:169 Identity:46/170 (27%)
Similarity:75/170 (44%) Gaps:18/170 (11%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL-PM 101
            |:|:..||::  .....::.:...:|::|..|..:.|||.:||:||.:||......||:..| ..
 Frog    82 EVFIGKIPQD--IYEDKLIPLFQSIGKLYEFRLMMTFSGLNRGFAYARYIGRRQAVSAIMTLNGY 144

  Fly   102 RFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLK--IHPFT--IVRVYEYQL----DQF 158
            ...:.| |:.|..||...||.|..:.|.|.     |..||  :...|  :..:..||.    .|.
 Frog   145 EITKGC-CIVVCRS
TEKSELALDGLPSHLE-----QPALKNILEEVTSGVSALSLYQSPSNESQV 203

  Fly   159 FYIFEYRNNDSAASAHQRV-RNSIRKFGEHAHISWLTAE 196
            ..|.:|.::.:||.|.:.: ..|....|....:|||..:
 Frog   204 LAIVKYDSHRAAAMAKKSLCEGSQFLRGLPLTVSWLKTD 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/78 (28%)
DUF3388 <127..169 CDD:288701 11/50 (22%)
dnd1NP_001037899.1 RRM1_DND1 80..157 CDD:240931 22/78 (28%)
RRM_SF 159..241 CDD:302621 22/87 (25%)
DND1_DSRM 276..357 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.