DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Dnd1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001102849.1 Gene:Dnd1 / 679841 RGDID:1583648 Length:352 Species:Rattus norvegicus


Alignment Length:167 Identity:39/167 - (23%)
Similarity:72/167 - (43%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRN---HSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL 99
            |:|:..:|::   |.     ::.:...:|.:|..|..:.|||.:||:||.:|.:....::|:..|
  Rat    59 EVFIGRLPQDVYEHQ-----LIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATL 118

  Fly   100 -PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPF------TIVRVYEYQLDQ 157
             ..:.|..|..| |..||...||.:..:..||....:   :|.:.|.      |::.........
  Rat   119 HNHQLRPSCQLL-VCRSTEKCELTVDGLPLSLNRRAL---LLALQPLGPCLQETLLLPSPGSAPS 179

  Fly   158 FFYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWL 193
            ...:.::..:.:||.|.:. |....|..||...:.||
  Rat   180 QIALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 21/80 (26%)
DUF3388 <127..169 CDD:288701 5/47 (11%)
Dnd1NP_001102849.1 hnRNP-R-Q 18..>219 CDD:273732 39/167 (23%)
DSRM_DND1 254..333 CDD:380745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.