Sequence 1: | NP_729346.1 | Gene: | tut / 317996 | FlyBaseID: | FBgn0052364 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139800.1 | Gene: | Rbm46 / 633285 | MGIID: | 3645057 | Length: | 533 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 46/195 - (23%) |
---|---|---|---|
Similarity: | 86/195 - (44%) | Gaps: | 33/195 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
Fly 100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
Fly 159 --FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAENILSRASGSFCFQREVSQNRTRRV 220
Fly 221 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tut | NP_729346.1 | RRM1_hnRNPR_like | 36..115 | CDD:240695 | 23/82 (28%) |
DUF3388 | <127..169 | CDD:288701 | 10/46 (22%) | ||
Rbm46 | NP_001139800.1 | hnRNP-R-Q | 5..464 | CDD:273732 | 46/195 (24%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 338..362 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0117 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |