DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and Rbm46

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001139800.1 Gene:Rbm46 MGIID:3645057 Length:533 Species:Mus musculus

Alignment Length:195 Identity:46/196 (23%)
Similarity:86/196 (44%) Gaps:33/196 (17%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|....|::|..|..::|||.:||||::.|...:..:.|::.|   
Mouse    62 EVFVGKIPRD--MYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRILNNY 124

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.:|..:|:      |.:|..|.:..:....:..::..||.|:....: |.||....|:.  
Mouse   125 EIRPGKFIGVCV------S
LDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDKTKN 183

  Fly   159 --FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAENILSRASGSFCFQREVSQNRTRRV 220
              |...||.::.:||.|.:: :..:.:.:|....:.|...|             :||.:...:||
Mouse   184 RGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPE-------------KEVDEETMQRV 235

  Fly   221  220
            Mouse   236  235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/83 (28%)
DUF3388 <127..169 CDD:288701 10/47 (21%)
Rbm46NP_001139800.1 RRM1_RBM46 60..137 CDD:240928 23/83 (28%)
RRM2_RBM46 139..223 CDD:240936 17/84 (20%)
RRM_SF 235..308 CDD:302621 1/2 (50%)
DND1_DSRM 392..468 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.