DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and rbm47

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_005168416.1 Gene:rbm47 ZFINID:ZDB-GENE-030131-9612 Length:601 Species:Danio rerio

Alignment Length:213 Identity:50/214 (23%)
Similarity:88/214 (41%) Gaps:48/214 (22%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|...:|.:|.||..:||.|.:||||::.|......:.|::.|   
Zfish    83 EIFVGKIPRD--VYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNNF 145

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.|...:|      .|.:|..|.:..:..:.:..::.:|:.|:....: |.||....|:.  
Zfish   146 EIRPGRLLGVC------SSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKN 204

  Fly   159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
              |...||.::.:||.|.:::. ..|:.:|....:.|.                         |:
Zfish   205 RGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETS 269

  Fly   196 ENILSRASGSF---CFQR 210
            |.||.:..|.|   |.:|
Zfish   270 EEILRQTFGQFNPGCVER 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 24/83 (29%)
DUF3388 <127..169 CDD:288701 9/47 (19%)
rbm47XP_005168416.1 hnRNP-R-Q 34..601 CDD:273732 50/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.