DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Syp

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:167 Identity:36/167 - (21%)
Similarity:80/167 - (47%) Gaps:12/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQ 97
            |.| |:|...||::  .....::.:....|.::.:|..:| .:|.:||||::.:.|.:...:|::
  Fly   203 GNGCEVFCGKIPKD--MYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVR 265

  Fly    98 YLPMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHP--FTIVRVY----EYQLD 156
            .|.....:....:.|..|.||..|.:.|:..:....::.:|..|..|  :.:: :|    :.:.:
  Fly   266 QLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVI-IYSSPDDKKKN 329

  Fly   157 QFFYIFEYRNNDSAASAHQRV-RNSIRKFGEHAHISW 192
            :.|...||.::.:|:.|.:|: ...|:.:|....:.|
  Fly   330 RGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 17/80 (21%)
DUF3388 <127..169 CDD:288701 7/47 (15%)
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 17/79 (22%)
RRM2_hnRNPR_like 286..367 CDD:240696 16/82 (20%)
RRM3_hnRNPR_like 381..452 CDD:240697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.