DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and DND1

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_919225.1 Gene:DND1 HGNCID:23799 Length:353 Species:Homo sapiens

Alignment Length:170 Identity:38/171 (22%)
Similarity:73/171 (43%) Gaps:26/171 (15%)


  Fly    38 ELFLSCIPRN---HSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL 99
            |:|:..:|::   |.     ::.:...:|.:|..|..:.|||.:||:||.:|.:....::|:..|
Human    59 EVFIGRLPQDVYEHQ-----LIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATL 118

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTIVRVYEYQL------ 155
               |:  |..|..| |..||...||.:..:..:|....:...:..:.|    .:.|.:|      
Human   119 HNHPL--RPSCPLL-VCRSTEKCELSVDGLPPNLTRSALLLALQPLGP----GLQEARLLPSPGP 176

  Fly   156 -DQFFYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWL 193
             .....:.::.::.:||.|.:. |.......||...:.||
Human   177 APGQIALLKFSSHRAAAMAKKALVEGQSHLCGEQVAVEWL 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/83 (27%)
DUF3388 <127..169 CDD:288701 4/49 (8%)
DND1NP_919225.1 LSM_int_assoc 18..>219 CDD:330438 38/171 (22%)
DND1_DSRM 253..333 CDD:317152
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.