DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and dnd1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_997960.1 Gene:dnd1 / 373074 ZFINID:ZDB-GENE-030828-4 Length:411 Species:Danio rerio


Alignment Length:102 Identity:34/102 - (33%)
Similarity:53/102 - (51%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAM-- 96
            |.| |:|:|.|| |.....| ::.:...:|.:|..|..::|||.:||:||.:|.:.....:|:  
Zfish    57 GSGCEVFISQIP-NDVYEDR-LIPLFQSIGTIYEFRLMMNFSGQTRGFAYAKYGDPLTASAAVTT 119

  Fly    97 --QY-LPMRFRQLCMCLRVEPSTNNRELVLKNVESSL 130
              || ||..     .||.|..||..|:|.|.::..|:
Zfish   120 LHQYRLPEG-----GCLTVRRSTEKRQLRLGDLPVSM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 27/84 (32%)
DUF3388 <127..169 CDD:288701 1/4 (25%)
dnd1NP_997960.1 RRM_SF 59..136 CDD:302621 27/83 (33%)
RRM2_DND1 138..220 CDD:240937 4/14 (29%)
DND1_DSRM 323..403 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.