DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and dnd1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_997960.1 Gene:dnd1 / 373074 ZFINID:ZDB-GENE-030828-4 Length:411 Species:Danio rerio


Alignment Length:102 Identity:34/102 - (33%)
Similarity:53/102 - (51%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAM-- 96
            |.| |:|:|.|| |.....| ::.:...:|.:|..|..::|||.:||:||.:|.:.....:|:  
Zfish    57 GSGCEVFISQIP-NDVYEDR-LIPLFQSIGTIYEFRLMMNFSGQTRGFAYAKYGDPLTASAAVTT 119

  Fly    97 --QY-LPMRFRQLCMCLRVEPSTNNRELVLKNVESSL 130
              || ||..     .||.|..||..|:|.|.::..|:
Zfish   120 LHQYRLPEG-----GCLTVRRSTEKRQLRLGDLPVSM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:409695 27/84 (32%)
dnd1NP_997960.1 RRM_SF 59..136 CDD:473069 27/83 (33%)
RRM_SF 138..220 CDD:473069 4/14 (29%)
DSRM_DND1 324..403 CDD:380745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.