DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and Hnrnpr

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_783193.2 Gene:Hnrnpr RGDID:631348 Length:632 Species:Rattus norvegicus

Alignment Length:199 Identity:46/200 (23%)
Similarity:91/200 (46%) Gaps:31/200 (16%)


  Fly    15 TITITT--RKV---LDENLKSLLDEGKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID 73
            |:.:||  ||.   ..:::.|.:..|.| |:|:..|||:  .....:|.:..:.|.::.:|..:|
  Rat   137 TLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRD--LYEDELVPLFEKAGPIWDLRLMMD 199

  Fly    74 -FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEP--------STNNRELVLKNVESS 129
             .||.:||||::.:..   ||:|.:.:     :||....:.|        |..|..|.:.::..:
  Rat   200 PLSGQNRGYAFITFCG---KEAAQEAV-----KLCDSYEIRPGKHLGVCISVANNRLFVGSIPKN 256

  Fly   130 LRPWQVYQEMLKIHPFTIVRVYEYQLD-----QFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHA 188
            .....:.:|..|:....:..:..:|.|     :.|...||.::.|||.|.:|:.: .::.:|...
  Rat   257 KTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVV 321

  Fly   189 HISW 192
            .:.|
  Rat   322 TVEW 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/89 (25%)
DUF3388 <127..169 CDD:288701 7/47 (15%)
HnrnprNP_783193.2 hnRNP-R-Q 106..627 CDD:273732 46/200 (23%)
RRM_SF 164..242 CDD:302621 22/88 (25%)
RRM2_hnRNPR 244..328 CDD:240932 16/83 (19%)
RRM3_hnRNPR 340..411 CDD:240938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.