Sequence 1: | NP_729346.1 | Gene: | tut / 317996 | FlyBaseID: | FBgn0052364 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005882.1 | Gene: | Rbm47 / 305340 | RGDID: | 1359713 | Length: | 590 | Species: | Rattus norvegicus |
Alignment Length: | 213 | Identity: | 49/213 - (23%) |
---|---|---|---|
Similarity: | 88/213 - (41%) | Gaps: | 48/213 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
Fly 100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
Fly 159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
Fly 196 ENILSRASGSF---CFQR 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tut | NP_729346.1 | RRM1_hnRNPR_like | 36..115 | CDD:240695 | 24/82 (29%) |
DUF3388 | <127..169 | CDD:288701 | 9/46 (20%) | ||
Rbm47 | NP_001005882.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
hnRNP-R-Q | 11..590 | CDD:273732 | 49/213 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0117 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |