DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and hrpr-1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_493049.2 Gene:hrpr-1 / 173086 WormBaseID:WBGene00002000 Length:611 Species:Caenorhabditis elegans


Alignment Length:250 Identity:52/250 - (20%)
Similarity:101/250 - (40%) Gaps:73/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQV---------NGTITITTRKVLD----ENLKSLLD---------------------- 33
            :|.|.||.:         .|...:|:.|:::    ..||:||:                      
 Worm   124 KSLYVTSLIRSFKDRCRQQGAAAVTSGKLINGPELAALKNLLETTGYTIEVTIGQRKFGGPPPDW 188

  Fly    34 -------EGKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYIN- 88
                   .|:| |:::..||.:  .....:|.:..:.|:::.:|..:| .||.|||||::.|.| 
 Worm   189 EGPATGPAGQGHEIYVGHIPTD--VFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNK 251

  Fly    89 VDLKESAMQY--------LPMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPF 145
            .|...:|..|        .|         |:|..|..|..|.:.|:..:....::.:| ||.|..
 Worm   252 EDAAAAAKTYDGHEISTGKP---------LKVNVSIANTRLFIGNIPKTKSKDEILEE-LKTHAE 306

  Fly   146 TIVRVYEYQL-------DQFFYIFEYRNNDSAASAHQRV-RNSIRKFGEHAHISW 192
            .:|.|..|.:       ::.|...::.::.:|:...::: ::.||.|....::.|
 Worm   307 GVVDVIVYSVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDW 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:409695 23/89 (26%)
hrpr-1NP_493049.2 NURR 61..137 CDD:410951 4/12 (33%)
hnRNP-R-Q 156..>445 CDD:273732 44/217 (20%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.