DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and SYNCRIP

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_006363.4 Gene:SYNCRIP HGNCID:16918 Length:623 Species:Homo sapiens

Alignment Length:169 Identity:39/170 (23%)
Similarity:83/170 (49%) Gaps:23/170 (14%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPM 101
            |:|:..|||:  .....:|.:..:.|.::.:|..:| .:|.:||||::.:..   ||:|.:.:.:
Human   163 EIFVGKIPRD--LFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCT---KEAAQEAVKL 222

  Fly   102 -------RFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKI-HPFTIVRVY----EYQ 154
                   ..:.:.:|:.|   .||| |.:.::..|....|:.:|..|: ...|.|.:|    :.:
Human   223 YNNHEIRSGKHIGVCISV---ANNR-LFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKK 283

  Fly   155 LDQFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHAHISW 192
            .::.|...||.::.:||.|.:|:.: .::.:|....:.|
Human   284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEW 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 19/85 (22%)
DUF3388 <127..169 CDD:288701 10/47 (21%)
SYNCRIPNP_006363.4 hnRNP-R-Q 103..615 CDD:273732 39/170 (23%)
Interaction with APOBEC1 400..561
8 X 3 AA repeats of R-G-G 448..559
3 X 4 AA repeats of Y-Y-G-Y 460..488
Interaction with SMN. {ECO:0000269|PubMed:11574476} 518..549
Bipartite nuclear localization signal. {ECO:0000255} 564..578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.