DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and HNRNPR

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001095868.1 Gene:HNRNPR HGNCID:5047 Length:636 Species:Homo sapiens

Alignment Length:202 Identity:48/203 (24%)
Similarity:93/203 (46%) Gaps:34/203 (17%)


  Fly    15 TITITT--RKV---LDENLKSLLDEGKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID 73
            |:.:||  ||.   ..:::.|.:..|.| |:|:..|||:  .....:|.:..:.|.::.:|..:|
Human   137 TLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRD--LYEDELVPLFEKAGPIWDLRLMMD 199

  Fly    74 -FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEP--------STNNRELVLKNVESS 129
             .||.:||||::.:..   ||:|.:.:     :||....:.|        |..|..|.:.::..:
Human   200 PLSGQNRGYAFITFCG---KEAAQEAV-----KLCDSYEIRPGKHLGVCISVANNRLFVGSIPKN 256

  Fly   130 LRPWQVYQEMLKIHPFT--IVRVYEY------QLDQFFYIFEYRNNDSAASAHQRVRN-SIRKFG 185
            .....:.:|..|:...|  :|.|..|      :.::.|...||.::.|||.|.:|:.: .::.:|
Human   257 KTKENILEEFSKVTGLTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWG 321

  Fly   186 EHAHISW 192
            ....:.|
Human   322 NVVTVEW 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/89 (25%)
DUF3388 <127..169 CDD:288701 9/50 (18%)
HNRNPRNP_001095868.1 hnRNP-R-Q 106..631 CDD:273732 48/203 (24%)
Nuclear localization signal. {ECO:0000255} 415..421
RNA-binding RGG-box 450..570
3 X 11 AA approximate repeats of D-D-Y-Y-G-Y-D-Y-H-D-Y 465..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.