| Sequence 1: | NP_729346.1 | Gene: | tut / 317996 | FlyBaseID: | FBgn0052364 | Length: | 230 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001135499.1 | Gene: | rbm47 / 100216039 | XenbaseID: | XB-GENE-976707 | Length: | 412 | Species: | Xenopus tropicalis | 
| Alignment Length: | 213 | Identity: | 47/213 - (22%) | 
|---|---|---|---|
| Similarity: | 87/213 - (40%) | Gaps: | 48/213 - (22%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99 
  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158 
  Fly   159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195 
  Fly   196 ENILSRASGSF---CFQR 210 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| tut | NP_729346.1 | RRM1_hnRNPR_like | 36..115 | CDD:240695 | 23/82 (28%) | 
| DUF3388 | <127..169 | CDD:288701 | 9/46 (20%) | ||
| rbm47 | NP_001135499.1 | hnRNP-R-Q | 13..>378 | CDD:273732 | 47/213 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||