DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and rbm47

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001135499.1 Gene:rbm47 XenbaseID:XB-GENE-976707 Length:412 Species:Xenopus tropicalis

Alignment Length:213 Identity:47/214 (22%)
Similarity:87/214 (41%) Gaps:48/214 (22%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|....|.::.||..:||.|.:||||::.:......:.|::.|   
 Frog    72 EVFVGKIPRD--VYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNY 134

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.|...:| |     |.:|..|.:..:....:..::.:|:.|:....: |.||....|:.  
 Frog   135 EIRPGRLLGVC-C-----SVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKN 193

  Fly   159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
              |...||.::.:||.|.:::. ..|:.:|....:.|.                         |:
 Frog   194 RGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETS 258

  Fly   196 ENILSRASGSF---CFQR 210
            |:.:.:..|.|   |.:|
 Frog   259 EDTIKKIFGQFNPGCVER 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/83 (28%)
DUF3388 <127..169 CDD:288701 9/47 (19%)
rbm47NP_001135499.1 hnRNP-R-Q 13..>378 CDD:273732 47/214 (22%)
RRM_SF 70..147 CDD:302621 23/83 (28%)
RRM2_RBM47 150..238 CDD:240935 17/88 (19%)
RRM3_RBM47 245..318 CDD:240941 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.