DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tut and syncrip

Sequence 1:NP_729346.1 Gene:tut FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_002933974.2 Gene:syncrip XenbaseID:XB-GENE-920046 Length:623 Species:Xenopus tropicalis

Alignment Length:208 Identity:45/209 (22%)
Similarity:90/209 (43%) Gaps:48/209 (23%)


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPM 101
            |:|:..|||:  .....:|.:..:.|.::.:|..:| .:|.:||||::.:..   ||:|.:.:.:
 Frog   163 EIFVGKIPRD--LFEDELVPLFEKAGSIWDLRLMMDPLTGLNRGYAFVTFCT---KEAAQEAVKL 222

  Fly   102 -------RFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKI-HPFTIVRVY----EYQ 154
                   ..:.:.:|:.|   .||| |.:.::..|....|:.:|..|: ...|.|.:|    :.:
 Frog   223 YNNHEIRPGKHIGVCISV---ANNR-LFVGSIPKSKTKEQIVEEFSKVTEGLTDVILYHQPDDKK 283

  Fly   155 LDQFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHAHISW-------------------------L 193
            .::.|...||.::.:||.|.:|:.: .::.:|....:.|                         .
 Frog   284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVVTVEWADPIEDPDPEVMAKVKVLFVRNLANT 348

  Fly   194 TAENILSRASGSF 206
            ..|.||.:|.|.|
 Frog   349 VTEEILEKAFGQF 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 19/85 (22%)
DUF3388 <127..169 CDD:288701 10/47 (21%)
syncripXP_002933974.2 hnRNP-R-Q 103..615 CDD:273732 45/209 (22%)
RRM1_hnRNPQ 161..239 CDD:240927 18/81 (22%)
RRM2_hnRNPQ 241..325 CDD:240933 20/85 (24%)
RRM3_hnRNPQ 337..408 CDD:240939 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.