DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12081 and Lztr1

Sequence 1:NP_001259343.1 Gene:CG12081 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster

Alignment Length:348 Identity:95/349 (27%)
Similarity:147/349 (42%) Gaps:99/349 (28%)


  Fly    46 HALNAH------TMRWTLVPQQLDDAGVPLKYPLVPFQRYGHTVVAYKDRIYIWGGRNDENLCNT 104
            :|||..      |.:||.:.:..:..|.         :|..||||||||.::::||.|.:|:.|.
  Fly   223 NALNVDFTSYTATHQWTRMLECAEFVGA---------KRSKHTVVAYKDAMFVFGGDNGKNMLND 278

  Fly   105 LYCFDPKTAQWSRPQVTGCLPGARDGHSACVIGNSMYIFGGFVDEIN------------------ 151
            |..|..|...|.|...||..|..|..|||.|.|:||:||||:..:|:                  
  Fly   279 LIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQS 343

  Fly   152 ------EFS-------------------------------SDVHSLNL-DTMEWRYVQTFG-VPP 177
                  :||                               :|:.:||| ...:|..|...| .||
  Fly   344 AMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPP 408

  Fly   178 SYRDFHASVAYEQERMYIFGGRGDKHSPYHSQEETYCHEIVYLDMKTKVWHR----PFTAG--KV 236
            :..:|..:||  ::.||:|.|:....         ..:.:.....||:.|.|    |...|  ..
  Fly   409 TCCNFPVAVA--RDAMYVFSGQSGLQ---------ITNSLFEFHFKTRTWRRISNEPVLRGATSA 462

  Fly   237 PVGRR-SHSMFVYNKLIYVFGG-YNGLLDQHFNDLYTFDPRTKLWNLIR--ANGKAPTARRRQCA 297
            |..|| .|:|..:::.:||||| .:..|.   |||:.:|..:::|::|:  .|...|:.|....:
  Fly   463 PPSRRYGHTMVHHDRFLYVFGGSADSTLP---NDLHCYDLDSQVWSVIQPEQNSDVPSGRVFHAS 524

  Fly   298 IVMGTRMFLFGGT---SPRSGSS 317
            .|:...|::||||   |.|.|.:
  Fly   525 AVICDAMYIFGGTVDNSVRRGDT 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965 7/29 (24%)
Kelch_6 13..60 CDD:290672 6/20 (30%)
KELCH repeat 78..125 CDD:276965 21/47 (45%)
Kelch_1 78..117 CDD:279660 18/39 (46%)
KELCH repeat 128..170 CDD:276965 20/98 (20%)
Kelch_3 137..188 CDD:290151 22/108 (20%)
KELCH repeat 180..236 CDD:276965 13/62 (21%)
Kelch_3 192..248 CDD:290151 15/63 (24%)
Kelch_5 237..276 CDD:290565 15/41 (37%)
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 91/335 (27%)
KELCH repeat 252..298 CDD:276965 21/46 (46%)
Kelch_3 261..310 CDD:290151 20/49 (41%)
Kelch_5 299..>329 CDD:290565 14/30 (47%)
KELCH repeat 302..355 CDD:276965 15/53 (28%)
Kelch_1 358..400 CDD:279660 5/42 (12%)
KELCH repeat 359..407 CDD:276965 7/48 (15%)
KELCH repeat 410..455 CDD:276965 12/56 (21%)
Kelch_1 410..452 CDD:279660 11/53 (21%)
Kelch_1 466..509 CDD:279660 16/46 (35%)
KELCH repeat 467..509 CDD:276965 15/45 (33%)
BTB 564..704 CDD:279045
BTB 575..707 CDD:197585
SPOP_C_like 707..766 CDD:269810
BTB 798..898 CDD:279045
BTB 802..902 CDD:197585
SPOP_C_like 902..960 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120902000
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
21.960

Return to query results.
Submit another query.