DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32313 and Pi16

Sequence 1:NP_001261262.1 Gene:CG32313 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 RGDID:1304760 Length:483 Species:Rattus norvegicus

Alignment Length:168 Identity:40/169 (24%)
Similarity:61/169 (36%) Gaps:67/169 (40%)


  Fly    24 RSLILEAHNRRRAKYGNQP------MVLDEELCTECSEYADEIV----RNEGVYTENYLEYLYA- 77
            :..::|.||..||:. :.|      |..|:||......||.:.|    :..|...||    |:| 
  Rat    39 KQTMVELHNHYRAQV-SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGEN----LFAI 98

  Fly    78 TD-----PISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYY--------------RFTAMI 123
            ||     |::                  |..|.      |..:||              .:|.::
  Rat    99 TDEGMDVPLA------------------VGNWH------EEHEYYNLSTATCDPGQMCGHYTQVV 139

  Fly   124 WNASTRLGVG------LGRIQET--RYLVVRYAPPGNI 153
            |:.:.|:|.|      |..::|.  ..||..|.||||:
  Rat   140 WSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 40/164 (24%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.