DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and D2062.1

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:167 Identity:42/167 - (25%)
Similarity:79/167 - (47%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQ 87
            |:.||:..||..|:|:|..|:|.|..:......:|||:.::..:..|...:|        .:::.
 Worm    47 LKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKY--------GENVA 103

  Fly    88 VVC-----VFREALPRECVRIWFHYRGFAENTKYYR---------FTAMIWNASTRLGVG--LGR 136
            :.|     ...:.|.:..|.: |:..|...:...::         ||.::|.:|.::|||  :|:
 Worm   104 MFCQSGCWPLPQTLAQAMVHL-FYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGK 167

  Fly   137 IQETRYL-----VVRYAPPGNILREM--ASNVPKRPT 166
            ..:..|:     .|::.||||:|.:.  .||| :|||
 Worm   168 SSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNV-QRPT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 32/146 (22%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 34/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.