DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32313 and D2062.1

Sequence 1:NP_001261262.1 Gene:CG32313 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans

Alignment Length:167 Identity:42/168 (25%)
Similarity:79/168 (47%) Gaps:33/168 (20%)


  Fly    23 LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQ 87
            |:.||:..||..|:|:|..|:|.|..:......:|||:.::..:..|...:|        .:::.
 Worm    47 LKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKY--------GENVA 103

  Fly    88 VVC-----VFREALPRECVRIWFHYRGFAENTKYYR---------FTAMIWNASTRLGVG--LGR 136
            :.|     ...:.|.:..|.: |:..|...:...::         ||.::|.:|.::|||  :|:
 Worm   104 MFCQSGCWPLPQTLAQAMVHL-FYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGK 167

  Fly   137 IQETRYL-----VVRYAPPGNILREM--ASNVPKRPT 166
            ..:..|:     .|::.||||:|.:.  .||| :|||
 Worm   168 SSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNV-QRPT 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 33/147 (22%)
D2062.1NP_001293506.1 SCP_GAPR-1_like 46..189 CDD:240182 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88248840
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10334
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.