powered by:
                   
 
    
    
             
          
            Protein Alignment CG32313 and D2062.1
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001261262.1 | Gene: | CG32313 / 317973 | FlyBaseID: | FBgn0052313 | Length: | 182 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001293506.1 | Gene: | D2062.1 / 24104374 | WormBaseID: | WBGene00017055 | Length: | 204 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 167 | Identity: | 42/167 - (25%) | 
          
            | Similarity: | 79/167 -  (47%) | Gaps: | 33/167 - (19%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    23 LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQ 87|:.||:..||..|:|:|..|:|.|..:......:|||:.::..:..|...:|        .:::.
 Worm    47 LKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKY--------GENVA 103
 
 
  Fly    88 VVC-----VFREALPRECVRIWFHYRGFAENTKYYR---------FTAMIWNASTRLGVG--LGR 136:.|     ...:.|.:..|.: |:..|...:...::         ||.::|.:|.::|||  :|:
 Worm   104 MFCQSGCWPLPQTLAQAMVHL-FYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGK 167
 
 
  Fly   137 IQETRYL-----VVRYAPPGNILREM--ASNVPKRPT 166..:..|:     .|::.||||:|.:.  .||| :|||
 Worm   168 SSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNV-QRPT 203
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C160161917 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG2340 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1528782at2759 | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR10334 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 5 | 4.850 |  | 
        
      
           
             Return to query results.
             Submit another query.