DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32313 and scl-2

Sequence 1:NP_001261262.1 Gene:CG32313 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_502503.1 Gene:scl-2 WormBaseID:WBGene00009895 Length:207 Species:Caenorhabditis elegans

Alignment Length:200 Identity:41/200 (21%)
Similarity:65/200 (33%) Gaps:71/200 (36%)


  Fly     6 ILFLIAIEV-CNQTIGIGLRSLILEAHNRRRAKY--------GNQ--------PMVLDEELCTEC 53
            :|.::|:.| |:...|...::.|:.|||..|:|.        |.|        .|..|..:....
 Worm     4 LLLVVALAVGCSADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASA 68

  Fly    54 SEYAD--------EIVRNEGVY---TENYL----EYLYATDPISAK---------HLQVVCVFRE 94
            ..||:        :....|.:|   |...|    :|..|......|         :|..:.:|  
 Worm    69 QNYANGCPTGHSGDAGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLF-- 131

  Fly    95 ALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGL--------GRIQETRYLVVRYAPPG 151
                              ||.....|.|.|..|..:|.|:        |..:.|  :|.:|.|.|
 Worm   132 ------------------NTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVT--VVCQYKPQG 176

  Fly   152 NILRE 156
            |.:.:
 Worm   177 NFINQ 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/174 (21%)
scl-2NP_502503.1 SCP 21..174 CDD:214553 33/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88597962
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.