DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32313 and GLIPR2

Sequence 1:NP_001261262.1 Gene:CG32313 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 HGNCID:18007 Length:169 Species:Homo sapiens

Alignment Length:161 Identity:41/162 (25%)
Similarity:65/162 (40%) Gaps:42/162 (26%)


  Fly    27 ILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIV----------RNEGVYTENYLEYLYATDPI 81
            :|:|||..|.|:|..|:.|.:.|..|..:|::.:.          .:.|...||.....|     
Human    28 VLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASY----- 87

  Fly    82 SAKHLQVVCVFREALPRECVRIW--------FHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQ 138
                        :...:|....|        |...||...|.:  ||||:|..:.::|||.....
Human    88 ------------DQTGKEVADRWYSEIKNYNFQQPGFTSGTGH--FTAMVWKNTKKMGVGKASAS 138

  Fly   139 E-TRYLVVRYAPPGNILRE--MASNV--PKR 164
            : :.::|.||.|.||::.|  ...||  ||:
Human   139 DGSSFVVARYFPAGNVVNEGFFEENVLPPKK 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/145 (25%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.