DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and sphe

DIOPT Version :10

Sequence 1:NP_572492.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:218 Identity:59/218 - (27%)
Similarity:92/218 - (42%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 CGGALIANNFVLTAAHCADLGGEPPSQVRLG---GDNLTLTEGEDISIRRVIIHPDY-------- 216
            |||::::...:||.|||....|:.....||.   |.......|:.:::..|.:||||        
  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLA 115

  Fly   217 ----SASTAYNDIALLELETAAKPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPL 277
                |:...|.| .:..:...|..|..|.      |.:..:|.  |:|:|| .|.:|.::.::.|
  Fly   116 VITLSSELTYTD-RITAIPLVASGEALPA------EGSEVIVA--GWGRTS-DGTNSYKIRQISL 170

  Fly   278 KSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLG---YVVGITSL 339
            |......|...|.........|..::..|       ||.||.||..:..:.|:|   :|||    
  Fly   171 KVAPEATCLDAYSDHDEQSFCLAHELKEG-------TCHGDGGGGAIYGNTLIGLTNFVVG---- 224

  Fly   340 GQGCASGPPSVYTRVSSFVDWIE 362
              .|.|..|.|:.|:||:.|||:
  Fly   225 --ACGSRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_572492.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 59/218 (27%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/218 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.