DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trf4-1 and Tut1

Sequence 1:NP_001259340.1 Gene:Trf4-1 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_932110.1 Gene:Tut1 MGIID:1917294 Length:869 Species:Mus musculus

Alignment Length:701 Identity:128/702 (18%)
Similarity:217/702 (31%) Gaps:240/702 (34%)


  Fly   190 AATTTGPATSMSDTSNNPPQST--TTPASRTNSIYYNPSRKKRPENKAGGAHYYMNNHMEMIAKY 252
            |.|...|..|:|.||....:|.  .||:|..         .:.|::..|.........:..::..
Mouse   258 ACTPASPLDSLSPTSVQESESLDFDTPSSLA---------PQTPDSALGSDTVTSPQSLPPVSPL 313

  Fly   253 KGEPWRKPDYPYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVVHSIWPQAVVEIFGS 317
            :.:  ||      ||..|...|:           .|.|.::|   :.||.       ||:|:.||
Mouse   314 QED--RK------EGKQGKELEL-----------AEEASKDE---KEEAA-------AVLELVGS 349

  Fly   318 FRTGLFLPTSDIDLVVLGLWEKLPLRTLEFELVSRGIAEACTVRVLDKASVPIIKLTDRETQVKV 382
            ...|          .|.|::.                     |:.:..|..|::|...|.:.:..
Mouse   350 ILRG----------CVPGVYR---------------------VQTVPSARRPVVKFCHRPSGLHG 383

  Fly   383 DISFNMQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLNEVFTGG--ISSYSLILMCISFL 445
            |:|.:.:..:.::..:.........:..||..|:.:   ...|.:..||  :::|:|.|:.|.||
Mouse   384 DVSLSNRLALYNSRFLNLCSEMDGRVRPLVYTLRCW---AQHNGLSGGGPLLNNYALTLLVIYFL 445

  Fly   446 QMHPRGIYHDTAN-----------------------------------LGVLLLEFF------EL 469
            |.....:....|.                                   |..||.:||      :|
Mouse   446 QTRDPPVLPTVAQLTQRAGEGEQVEVDGWDCSFPKDASRLEPSTNVEPLSSLLAQFFSCVSCLDL 510

  Fly   470 YGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLTPGNDIGRSSYGVFQVQQAF 534
            .|..       :|::.|...|..:.|..|:.:|.|...:.::||                    |
Mouse   511 SGSL-------LSLREGRPLMVAEGLPSDLWEGLRLGPMNLQDP--------------------F 548

  Fly   535 KCAYRVLALAVSPLNLLG-IDPRVNSILG------RIIHITDDVIDYREWIRENFEHLVVVDRIS 592
            ..::.|.|      |:.| :..|:.|..|      |.:.........|:|              .
Mouse   549 DLSHNVAA------NVTGRVAKRLQSCCGAAASYCRSLQYQQRSSRGRDW--------------G 593

  Fly   593 PLPTAAPTAYATANGAPKYVIMPSGAVVQQLYHHPVQVPTAHGHSHAHSHSHGHAHPGAHLCQPY 657
            .||...|::.::...| |.:.:|| |...|:....|.|.......|....:......||.:... 
Mouse   594 LLPLLQPSSPSSLLSA-KLIPLPS-APFPQVIMALVDVLREALGCHIEQGTKRRRSEGARIKDS- 655

  Fly   658 VTGTTVSAVTTTTTMAVVTVGVSAGGVQQQQQQQNATAHTHSQQQTQNQSQSRHRRGSTSSGDDS 722
                                  ..|||.::|:   ......|.::.:.:.|.       .:||.|
Mouse   656 ----------------------PLGGVNKRQR---LGGQEKSFEEGKEEPQG-------CAGDHS 688

  Fly   723 EDSKDGDVVETTSSAQEVV---------DIALSTPNGLANMSMPMPVHAVGMPASNSWSGNGNGN 778
            |:..:..|:|...:.|:..         ::.|.|.|.|...       |...|.....:|.|   
Mouse   689 ENEVEEMVIEVRETPQDWALLHSGPPEEELPLMTANCLDKA-------AEHNPMKPEVAGEG--- 743

  Fly   779 GNSSSSTGSSPEIAHIAAQEMDPELEDQ-----------QQQQQHQETSGG 818
              |...||.  |.:|.::......|..|           .|||..:|..||
Mouse   744 --SQGETGK--EASHPSSVSWRCALWHQVWQGRRRARRRLQQQTKEEGRGG 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 18/110 (16%)
PAP_assoc 458..518 CDD:281779 16/101 (16%)
Tut1NP_932110.1 ZnF_U1 14..47 CDD:197732
RRM_TUT1 54..127 CDD:240725
RRM <56..>140 CDD:223796
NT_PAP_TUTase 179..403 CDD:143392 39/214 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.