DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trf4-1 and gld-2

Sequence 1:NP_001259340.1 Gene:Trf4-1 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_491842.2 Gene:gld-2 WormBaseID:WBGene00001596 Length:1113 Species:Caenorhabditis elegans

Alignment Length:964 Identity:176/965 (18%)
Similarity:295/965 (31%) Gaps:430/965 (45%)


  Fly    63 NNNNNNII-------NNTITNTTNNTGNNSSAKPYLSRPYSSLNRVLNFRADSL----------- 109
            |..|:|:.       .:::..::.||.|:|.|.|      ..:.|::....|.:           
 Worm   402 NQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADP------EEMPRIMEKLDDEVTGADHDKTIDE 460

  Fly   110 ---EILQQQQ-----QQQQLN----GTTQRNS--TNINTTSGGSTSSSADSTTNRDNNSPANSSS 160
               .|.:.|:     :::.||    ...:|||  ::|::.|..|:.|:.|.:| .....|     
 Worm   461 NRRRIHKSQEPRIGTEEKALNELPRKANRRNSSCSSISSVSESSSPSALDEST-LTKILP----- 519

  Fly   161 TNGPGAGTGTSTGAGGTGTNSPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNSIYYNP 225
                     |....||.|..||                       :||.|..:            
 Worm   520 ---------TDNFRGGRGFASP-----------------------SPPTSLLS------------ 540

  Fly   226 SRKKRPENKAGGAHYYMNNHMEMIAKYKGEPWRKPDYPYGEGVIGLHEEIEHFYQYVLPTPCEHA 290
                                         ||..:.|.        |.|:|..::..|..|     
 Worm   541 -----------------------------EPLSRMDV--------LSEKIWDYHNKVSQT----- 563

  Fly   291 IRNEVVKR-------IEAVVHSIWPQAVVEIFGSFRTGLFLPTSDIDL----------------V 332
              :|:::|       :...:..::|.:.:.:.||...|....:||:||                |
 Worm   564 --DEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVV 626

  Fly   333 VLGLWEKLPLRTLEFELVSRGIAEACTVRVLDKASVPIIKLTDRE--TQVKVDISFNMQSGVQSA 395
            ||    .|.|.||::|       :....:.|..|.|||:::....  ..:.||::.|....:::.
 Worm   627 VL----NLILSTLQYE-------KFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNT 680

  Fly   396 ELIKKFKR-DYPVLEKLVLVLKQFLLLRDLNEVFTGGISSYSLILMCISFLQMHPRGI------- 452
            .|:..:.. |:.| ..||.|:|::...:.:|:......:||||:||.|.|||..|..:       
 Worm   681 HLLCYYSSYDWRV-RPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQS 744

  Fly   453 ------------------------------YHDTANLGVLLLEFFELYGRRFNYMKIGISIKNGG 487
                                          ..:...||.||:.|.:.|...|||.:..|||:.|.
 Worm   745 YPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQGR 809

  Fly   488 RYMPKDELQRDMVDGHRPSLLCIEDPLTPGNDIGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLG 552
            |                                         |::|        ||||.|.    
 Worm   810 R-----------------------------------------VERA--------ALAVRPK---- 821

  Fly   553 IDPRVNSILGRIIHITDDVIDYREWIRENFEHLVVVDRISPLPTAAPTAYATANGAPKYVIMPSG 617
                                     |..|.|.    |:.:|.|:::.:..:..||....:.|   
 Worm   822 -------------------------IHSNSEG----DKETPPPSSSASTSSIHNGGTPGIPM--- 854

  Fly   618 AVVQQLYHHPVQVP--------------------TAH---------GHSHAHSHSHG---HAHPG 650
                   ||.:..|                    |||         ....|...:||   |.|..
 Worm   855 -------HHSISNPHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFEAIKKAFREAHGELQHNHDL 912

  Fly   651 AHL--CQPYVTGTTVSAVTTTTTMAVVTVGVSAGGVQQQQQQQNATA-----------------H 696
            ..|  |:|      :.|.||.|..||  ...:..|.:...||.|..|                 |
 Worm   913 DKLMECEP------IKASTTNTGAAV--FAATYEGERPLAQQPNTIACASLRVLNSIPVSSGPGH 969

  Fly   697 THSQQQTQNQSQSRHRRGSTSSGDDSEDSK--DGDVVETTSSAQEVVDIALSTPNGLANMSMPMP 759
            .|.|||: ||:.||.:|..::.|....:::  :|:..:...:.:                     
 Worm   970 YHYQQQS-NQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRR--------------------- 1012

  Fly   760 VHAVGMPASNSWSGNGNGNGNSSSSTGSSPEIAHIAAQEMDPELEDQQQQQQHQETSGGNGFIRP 824
                   :.|:.|.:..|||::...:..|.|           .:.|..:||..|:          
 Worm  1013 -------SFNNQSSSNPGNGSTGPRSSRSNE-----------NVRDSSRQQNSQK---------- 1049

  Fly   825 GDVGTGSNRGGGDGSGGRNYNQRNNHNSSGYYHQQYYVPPPMQQQLSKSNSSSN 878
                         ||.|.:.::.|..:::|       ||...:||.|......|
 Worm  1050 -------------GSSGVSVSKENVASTTG-------VPVDKKQQNSNRKDDGN 1083

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 27/135 (20%)
PAP_assoc 458..518 CDD:281779 14/60 (23%)
gld-2NP_491842.2 MPLKIP 32..>120 CDD:292140
NT_PAP_TUTase 569..687 CDD:143392 26/129 (20%)
PAP_assoc 780..>814 CDD:281779 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.