DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trf4-1 and TENT4A

Sequence 1:NP_001259340.1 Gene:Trf4-1 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_008930.2 Gene:TENT4A HGNCID:16705 Length:792 Species:Homo sapiens

Alignment Length:918 Identity:322/919 (35%)
Similarity:425/919 (46%) Gaps:207/919 (23%)


  Fly     1 MDPFVGWFQKEQEGPSLCTWLKIWETNAQEMGALLNQQLQQATTINGS--------------TSS 51
            |||.|.|.|.||:||:...|::||||:             |.....||              |::
Human     1 MDPRVAWIQPEQKGPANALWMQIWETS-------------QGVGRGGSGFASYFCLNSPALDTAA 52

  Fly    52 SSSSSNSGNNNNNNNNNIINNTITNTTNNTGNNSSAKPYLSRPYSSLNRVLNFRADSLEILQQQQ 116
            ::.::..|                     :|....|.|..|.|..............|..|....
Human    53 AAGAAGRG---------------------SGGLGPALPAASPPPPGPTAPAALPPALLTALGPAA 96

  Fly   117 QQQQLNGTTQRNSTNINTTSGGSTSSSADSTTNRD--NNSPANSSSTNGPGAGTGTSTGAGGTGT 179
            :     |..:.:.:...::|..|:||:|:|.|...  ::|.::|:|...||.      |.||...
Human    97 E-----GARRLHKSPSLSSSSSSSSSNAESGTESPGCSSSSSSSASLGRPGG------GRGGAFF 150

  Fly   180 NSPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNSIYYNPSRKKRPENKAG--GAHYYM 242
            |. |..|.|...|..|          :|......||...:...::|.|:|| ||||.  |.:|.:
Human   151 NF-ADGAPSAPGTANG----------HPGPRGPAPAGSPSQHQFHPGRRKR-ENKASTYGLNYLL 203

  Fly   243 NNHMEMI----------AKYKGEPWRKPDYPYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVK 297
            :......          |...|.||:  ...|..|:.||||||..||.::.|.|.|.|:|.||||
Human   204 SGSRAAALSGGGGPGAQAPRPGTPWK--SRAYSPGIQGLHEEIIDFYNFMSPCPEEAAMRREVVK 266

  Fly   298 RIEAVVHSIWPQAVVEIFGSFRTGLFLPTSDIDLVVLGLWEKLPLRTLEFELVSRGIAEACTVRV 362
            |||.||..:||.|.|:|||||.|||:||||||||||.|.||:.||:.||..|....:||.|:::|
Human   267 RIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKV 331

  Fly   363 LDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLNEV 427
            ||||:||||||||:||:|||||||||::||::||.||.:.:.|.:|..|:||||||||.||||||
Human   332 LDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEV 396

  Fly   428 FTGGISSYSLILMCISFLQMHPR-GIYHDTANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMP 491
            |||||||||||||.|||||:||| .......|||:||:||||||||.|||:|.||.||.||.|:.
Human   397 FTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIA 461

  Fly   492 KDELQRDMVDGHRPSLLCIEDPLTPGNDIGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLGIDPR 556
            |:|:.:.|..|:|||:|||||||.||||:||||||..||:|.|..||.||:.|||||.....:..
Human   462 KEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRD 526

  Fly   557 VNSILGRIIHITDDVIDYREWIRENF-----------EHLVVVDRISPLPTAAPTAYATANGAPK 610
            ..|.|||||.:|.:|||||.||:|.:           ..:.:.:||           ||.||...
Human   527 AESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKIKERI-----------ATCNGEQT 580

  Fly   611 YVIMPSGAVVQQLYHHPVQVPTAHGHSHAHSHSHGHAHPGAHLCQPYV--TGTTVSAVTTTTTMA 673
            ....|.....|:|                          ...|..|.:  :|::.|:|:      
Human   581 QNREPESPYGQRL--------------------------TLSLSSPQLLSSGSSASSVS------ 613

  Fly   674 VVTVGVSAGGVQQQQQQQNATAHTHSQQQTQNQSQSRHRRGSTSSGDDSEDSKDGDVVETTSSAQ 738
                  |..|..........|  |.|..|...|:.:....|..:    :.....|....|||.. 
Human   614 ------SLSGSDVDSDTPPCT--TPSVYQFSLQAPAPLMAGLPT----ALPMPSGKPQPTTSRT- 665

  Fly   739 EVVDIALSTPNGLANMSMPMP----------------------VHAVGMPASNSWSGNGNGNGNS 781
                 .:.|.|.....::|.|                      ||.:..||..|          :
Human   666 -----LIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPS----------A 715

  Fly   782 SSSTGSSPEIAHIAAQEMDPELEDQQQQQQHQETSGGNGFIRPGDVGTGSNRGGGDGSGGRNYN- 845
            |.:..|||.:.|.....|...::.     .|..|.|| |:   ..||:|..|......|...|| 
Human   716 SPNPLSSPHLYHKQHNGMKLSMKG-----SHGHTQGG-GY---SSVGSGGVRPPVGNRGHHQYNR 771

  Fly   846 ---QRNNH 850
               :|..|
Human   772 TGWRRKKH 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 73/110 (66%)
PAP_assoc 458..518 CDD:281779 40/60 (67%)
TENT4ANP_008930.2 PAP_assoc 240..>545 CDD:332051 194/305 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.831874 Normalized mean entropy S2207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001440
OrthoInspector 1 1.000 T609270
orthoMCL 1 0.900 OOG5_127416
Panther 1 1.100 O PTHR23092
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2219
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.