DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG10477

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:272 Identity:77/272 - (28%)
Similarity:122/272 - (44%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 PRE-SATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAH 375
            ||: ||...|.|    |:..|.:|....:|:...|.:    ..:|..:.||||:|.:.:|:|:||
  Fly    27 PRDSSAVPSIDG----RITNGNKAAANQFPYQVGLSF----KSSAGSWWCGGSIIANTWVLTAAH 83

  Fly   376 CINPMLTL-------VRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGAL 433
            |.....::       ||..| .|.:...|.       :.|.|..::..::.|||:||:...| ..
  Fly    84 CTKGASSVTIYYGSTVRTSA-KLKKKVSSS-------KFVQHAGYNAATLRNDISLIKTPSV-TF 139

  Fly   434 PGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGV-TSQVLRDAQVPIVSRHSCEQSYKSIF 497
            ..:|:.|.||..|. ....:.|.....:|||......: .:..|:.||..:::...|::::.|..
  Fly   140 TVSINKIALPAIAS-SYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSV 203

  Fly   498 QFVQFSDKVLCAGS-SSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSF----GYECARPNFPGV 557
                .:..|:|..| :....|||||||||.:..        .|:|:.||    |.|   .|.|..
  Fly   204 ----VTSGVICVESINKKSTCQGDSGGPLALNN--------RLIGVTSFVSSKGCE---KNAPAG 253

  Fly   558 YTRVASYVPWIK 569
            :|||.||:.|||
  Fly   254 FTRVTSYLDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 68/253 (27%)
Tryp_SPc 328..571 CDD:238113 70/255 (27%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/253 (27%)
Tryp_SPc 40..267 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.