DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG30414

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:120/275 - (43%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 VVGGMEARKGAYPW-IAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCI-------------- 377
            :.||.:|...:.|| :..||          :.|||||||.||:|:|:||||              
  Fly    41 ITGGADAGLFSNPWMVKVLG----------EKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKT 95

  Fly   378 -------------NPMLTLVRLGAHDLSQPAES----GAMDLRIRRTVVHEHFDLNSISNDIALI 425
                         :..|..:|||.:|...|.:.    .:.:|.:.|.::|..::|| :.|||.|:
  Fly    96 RFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLN-LDNDIGLL 159

  Fly   426 ELNVVGALPGNISPICLPEAAKFMQQDFVGMNPF--VAGWGAVKHQGVTSQVLRDAQVPIVSRHS 488
            .:.........:.||||      :.:..:..:|.  :.||| |.:.|..|:.|:.|.|.....|.
  Fly   160 RMKSFVQYSDYVRPICL------LVEGHMAESPIFNITGWG-VTNDGTPSRRLQRATVYNTDLHF 217

  Fly   489 CEQSYKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPN 553
            |...:..     |..:..:||..::.|||.|||||||.........:..:..||||:| ..|..:
  Fly   218 CRSKFTK-----QVDESQICAAGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYG-SAACHS 276

  Fly   554 FPGVYTRVASYVPWI 568
            | .|||.|..:..||
  Fly   277 F-SVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 77/273 (28%)
Tryp_SPc 328..571 CDD:238113 79/275 (29%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 77/273 (28%)
Tryp_SPc 41..290 CDD:238113 77/273 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.