DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and f7i

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_775335.1 Gene:f7i / 282671 ZFINID:ZDB-GENE-021206-10 Length:443 Species:Danio rerio


Alignment Length:305 Identity:79/305 - (25%)
Similarity:128/305 - (41%) Gaps:79/305 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 VSPSFYPPPPPPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFL 359
            ||...||....|...|            .:.|:.:||:...:|..||...:.|..|:       :
Zfish   165 VSQVDYPCGKIPVQKN------------TSQNQFLGGIHCPRGHCPWQVLIDYNGES-------V 210

  Fly   360 CGGSLIHSRYVITSAHCINP----MLTLVRLGAHDL------SQPAESGAMDLRIRRTVVHEHFD 414
            |||:|:...::||:|||::.    .|..| .|.|||      .:|.|..|:       .:|.::|
Zfish   211 CGGALLEGPWLITAAHCVHQKDTRFLKAV-TGEHDLDVLDGSEEPYEVSAV-------FIHPNYD 267

  Fly   415 LNSISNDIALIELNVVGALPGNISPICLPE---------AAKFMQQDFVGMNPFVAGWG--AVKH 468
            ..::.:|:||:.|.|.........|||||.         ||:|..         ::|||  ...|
Zfish   268 PETLDSDLALLRLRVPVQRSLYAVPICLPTPQLARSELWAARFHT---------LSGWGTRTAGH 323

  Fly   469 --------QGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVD--ACQGDSGG 523
                    :|..|..|:...||::....|..:..:...|        |||.:..|  :|:|..|.
Zfish   324 NLRREKGLKGPASGTLQRLAVPLLPAAQCGNANTTANMF--------CAGYTEGDHASCRGHDGS 380

  Fly   524 PLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVASYVPWI 568
            ||:....|.:    :|.|:||:|..|..|.:..:||:|.:::.|:
Zfish   381 PLVTRYGETS----FLTGVVSWGRGCGPPGYYWIYTKVENFLIWM 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 71/271 (26%)
Tryp_SPc 328..571 CDD:238113 72/272 (26%)
f7iNP_775335.1 GLA 20..82 CDD:214503
EGF_CA <91..120 CDD:238011
FXa_inhibition 129..164 CDD:291342
Tryp_SPc 188..420 CDD:214473 71/267 (27%)
Tryp_SPc 188..420 CDD:238113 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.