DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and AgaP_AGAP001246

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_321901.4 Gene:AgaP_AGAP001246 / 1281921 VectorBaseID:AGAP001246 Length:283 Species:Anopheles gambiae


Alignment Length:244 Identity:67/244 - (27%)
Similarity:118/244 - (48%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINP-----MLTLV 384
            |.|:|||.|..: ..|::.:|       |::...:||.|:|::::.:::|||.:|     .|||:
Mosquito    53 SGRIVGGTELTE-PLPYLLSL-------RDSGFHICGASIINAKHALSAAHCQSPPSDVNRLTLL 109

  Fly   385 RLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPICLPEAAKFM 449
               |....:..|:..:..::.....|..|.|.:..:|:|:|.:........|::.|.|......:
Mosquito   110 ---AGITKRTDETNGILFKVANVTTHPDFSLKTYLSDVAIIRIVTSFLDHPNLAAIPLISTTYKL 171

  Fly   450 QQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSV 514
            :...|..   |:|||......:.:..||..::||||..||...::.    |......:|||....
Mosquito   172 RVSSVAS---VSGWGLTAQDSMLAPTLRTVRIPIVSYSSCVNKWRP----VPIVWTAICAGHPGR 229

  Fly   515 DACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVAS 563
            |:|.|||||||:...::        :||||:|.:....::||:||.|.:
Mosquito   230 DSCNGDSGGPLVQDGVQ--------IGLVSWGADRCGSDYPGIYTYVGN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 66/242 (27%)
Tryp_SPc 328..571 CDD:238113 65/241 (27%)
AgaP_AGAP001246XP_321901.4 Tryp_SPc 55..270 CDD:214473 66/240 (28%)
Tryp_SPc 56..270 CDD:238113 65/239 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.