DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:281 Identity:96/281 - (34%)
Similarity:147/281 - (52%) Gaps:47/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 SPSFYPPPPPPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLC 360
            ||||.|.|                 ..|...|:|||.|......|:..:|.|.:.:|       |
Mosquito    33 SPSFSPRP-----------------RYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHN-------C 73

  Fly   361 GGSLIHSRYVITSAHC---INPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDI 422
            |||::.|::|:|:|||   .:|....||||.   |:.|..|.: :|:.|.|.|..:|.:||..|.
Mosquito    74 GGSVLSSKWVLTAAHCTAGASPSSLTVRLGT---SRHASGGTV-VRVARVVQHPKYDSSSIDFDY 134

  Fly   423 ALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRH 487
            :|:||........::.|:.||:..:.::.   |....|:|||..:....::.|||.|.||.|::.
Mosquito   135 SLLELEDELTFSDSVQPVGLPKQDETVKD---GTMTTVSGWGNTQSAAESNAVLRAANVPTVNQK 196

  Fly   488 SCEQSYKSIFQFVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECA 550
            .|.::|.   :|...:|::||||  ....|||||||||||:   .:|.     |:|:||:||.||
Mosquito   197 ECNKAYS---EFGGVTDRMLCAGYQQGGKDACQGDSGGPLV---ADGK-----LVGVVSWGYGCA 250

  Fly   551 RPNFPGVYTRVASYVPWIKKH 571
            :..:||||:|||....|::::
Mosquito   251 QAGYPGVYSRVAVVRDWVREN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 88/245 (36%)
Tryp_SPc 328..571 CDD:238113 88/247 (36%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 88/245 (36%)
Tryp_SPc 48..271 CDD:238113 88/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.