DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and AgaP_AGAP004900

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_314989.4 Gene:AgaP_AGAP004900 / 1275705 VectorBaseID:AGAP004900 Length:265 Species:Anopheles gambiae


Alignment Length:255 Identity:69/255 - (27%)
Similarity:123/255 - (48%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 NRVVGGMEARKGAYPWIAALGYFEENNRNAL-KFLCGGSLIHSRYVITSAHCIN---PMLTLVRL 386
            :::|.|.:|....||::.:|       |.|. ...||||:::.|:::|:|||::   |:...:::
Mosquito    29 SKIVNGTDAAIENYPFVVSL-------RGASGGHSCGGSILNDRWILTAAHCVDYTTPLYQTIQV 86

  Fly   387 GAHDLSQPAESGAMDLRIRRTVVHEHFD-LNSISNDIALIELNVVGALPGNISPICLPEAAKFMQ 450
            |..|:|:..:...  ..|...|:|..:: .:|..:||||::|.........:.|:.||:  :|.:
Mosquito    87 GRADISRTEDESV--YAIEDVVIHPGYNPADSYIDDIALLKLRKPLVFTDQVQPVRLPK--RFFE 147

  Fly   451 QDFVGMN-PFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAG--SS 512
            .|....| ..:.|||.....|.....|::.....|....|.:.:.:.....|     :||.  ..
Mosquito   148 IDVQESNLVTLVGWGRNASDGPVQTTLQEIDYYAVPNDECNRIHSNHIYPTQ-----ICAAEPGG 207

  Fly   513 SVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYE-CARPNFPGVYTRVASYVPWIKKH 571
            ....|.|||||||        :|:.:.:|:||:..: ||...:|||.|:|:.||.:|.:|
Mosquito   208 GKGQCSGDSGGPL--------IYKEFQVGIVSWSIKPCAIAPYPGVLTKVSYYVDFINQH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 67/249 (27%)
Tryp_SPc 328..571 CDD:238113 68/251 (27%)
AgaP_AGAP004900XP_314989.4 Tryp_SPc 30..256 CDD:214473 67/249 (27%)
Tryp_SPc 31..259 CDD:238113 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.