DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and LOC108647852

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:277 Identity:94/277 - (33%)
Similarity:144/277 - (51%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TCGISGATSN-----RVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHC 376
            ||||.....|     ||:.|.....|::||:|::....::...:   .|||.|:.:|:|:|:|||
 Frog    28 TCGIRPLVKNHHRVRRVIEGNTPEPGSWPWMASIQLLYKDGYGS---ACGGVLLSNRWVVTAAHC 89

  Fly   377 INPM-----LTLVRLGAHDLSQPAESGAMDLR-IRRTVVHEHFDLNSISNDIALIELNVVGALPG 435
            ::.:     |..:.|||.||:|....  ..:| |::.:.||.||..:..||||||.||.......
 Frog    90 LSDLKRYRHLARIVLGARDLTQLGPE--TQIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSD 152

  Fly   436 NISPICL-PEAAKFMQQDFVGMNPFVAGWGAV--KHQGVTSQVLRDAQVPIVSRHSCEQS--YKS 495
            .|.|.|| |:::...:.|    :..:||||.:  |.:.||: :|::|.|.::.|..|..|  |..
 Frog   153 YIQPACLPPKSSNVYKMD----DCHIAGWGLLNEKPRTVTT-MLQEATVELIDRKRCNSSDWYNG 212

  Fly   496 IFQFVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVY 558
                 ...|..||||  ....|.|.||||||||..:.:..:|  |::|:||:|..|.:|:..|||
 Frog   213 -----GIHDDNLCAGYEQGGPDVCMGDSGGPLMCKRKKAGIY--YVVGIVSWGGLCGQPHSNGVY 270

  Fly   559 TRVASYVPWIKKHIASA 575
            |.|..:..||....:|:
 Frog   271 TSVQDFEQWIFNKTSSS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 86/253 (34%)
Tryp_SPc 328..571 CDD:238113 87/255 (34%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 85/252 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.