DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32241 and CG13615

Sequence 1:NP_729000.2 Gene:CG32241 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651261.2 Gene:CG13615 FlyBaseID:FBgn0039199 Length:331 Species:Drosophila melanogaster

Alignment Length:111 Identity:39/112 (35%)
Similarity:49/112 (44%) Gaps:38/112 (34%)


  Fly   241 PVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDG 305
            |.:|..|..|:    |||||       ||||||       ||||||||     :||         
  Fly   103 PRHVGKPKAKL----PPPPP-------PPPPPP-------PPPPPPPP-----SPP--------- 135

  Fly   306 YHYGQPSVKFEVSAPPAPKVEYL-PPPPTKKVYVAPPVYVPPPTKK 350
               |.|:  ..||.||.|.:..| |..|.:..|.|.|..:|..:::
  Fly   136 ---GVPA--NPVSLPPQPVIVPLNPADPIQSFYFAYPQGIPTLSRR 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
CG13615NP_651261.2 DM4_12 225..320 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.