powered by:
Protein Alignment CG32241 and CG13615
DIOPT Version :9
Sequence 1: | NP_729000.2 |
Gene: | CG32241 / 317934 |
FlyBaseID: | FBgn0052241 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651261.2 |
Gene: | CG13615 / 42916 |
FlyBaseID: | FBgn0039199 |
Length: | 331 |
Species: | Drosophila melanogaster |
Alignment Length: | 111 |
Identity: | 39/111 - (35%) |
Similarity: | 49/111 - (44%) |
Gaps: | 38/111 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 PVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDG 305
|.:|..|..|: ||||| |||||| |||||||| :||
Fly 103 PRHVGKPKAKL----PPPPP-------PPPPPP-------PPPPPPPP-----SPP--------- 135
Fly 306 YHYGQPSVKFEVSAPPAPKVEYL-PPPPTKKVYVAPPVYVPPPTKK 350
|.|: ..||.||.|.:..| |..|.:..|.|.|..:|..:::
Fly 136 ---GVPA--NPVSLPPQPVIVPLNPADPIQSFYFAYPQGIPTLSRR 176
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32241 | NP_729000.2 |
None |
CG13615 | NP_651261.2 |
DM4_12 |
225..320 |
CDD:214785 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.