DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and CG14125

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster


Alignment Length:220 Identity:51/220 - (23%)
Similarity:70/220 - (31%) Gaps:62/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KPT-PPRPVYTP--PVVIPSEPAGVLKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVIAPP 127
            ||| .|:|...|  |...|.:|.    ||.            |..|....:....||.|..:.| 
  Fly    33 KPTASPKPPEDPDDPTDDPWDPT----DDS------------SEDPSDSTDEPWKPTAKPTVVP- 80

  Fly   128 PVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVV 192
               ..||: .:..|..|..||:..:  .|...||     ...|..||::....|..|...|....
  Fly    81 ---TEPPS-NITSTENPSEPTENPL--NPTGSPT-----NDEPSEPTEESTENPSDPTGQPTGET 134

  Fly   193 YTP------PPTGILKDDGYHYGQPSVK-FEVSAPPAPKV------EYLPPPTKKVVIAPPPVYV 244
            ..|      .||          |||:.: .|.:..||.:.      :....||.:..|   |.:.
  Fly   135 SNPSDQPTDSPT----------GQPTQETTEETKIPAGETTNEGTSDSTEEPTGEPSI---PTHE 186

  Fly   245 PPPTKKVIYTPPPPPPTKKVVYTPP 269
            |..:     :..|..||.....|.|
  Fly   187 PEES-----SGDPSDPTSATTQTIP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.