DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32241 and CG13138

Sequence 1:NP_729000.2 Gene:CG32241 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_609372.1 Gene:CG13138 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster

Alignment Length:206 Identity:50/207 (24%)
Similarity:77/207 (37%) Gaps:54/207 (26%)


  Fly   149 KKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV 213
            |:::.|.|.|.|.:|||:.     |.:|:|          :|:|:.|....:..:...|.     
  Fly   182 KELIKTVPQPYPVEKVVHV-----PIEKIV----------EKIVHVPKLVNVTVEKIVHV----- 226

  Fly   214 KFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPP------TKKVIYTPPPPPPTKKVVYTPPPPP 272
                   |..|:      .:||:..|.||.||.|      .:|:::.|.|.|    |:.|.|.|.
  Fly   227 -------PIEKI------VEKVIHIPKPVQVPKPYVVEKIIEKIVHVPKPYP----VLRTVPYPV 274

  Fly   273 PTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV----------KFEVSAPPAPKVEY 327
            ..|..|:.....|.|.|..|....|..|...:.|.:...|:          ||.:.....|..|:
  Fly   275 EIKVPVHLEKKVPVPYKVEVERKVPVYIRSSEPYKFESSSLYESYPRGEEFKFNMEMDHPPPREH 339

  Fly   328 LPPP-PTKKVY 337
            .|.. |:...|
  Fly   340 EPSSLPSSNYY 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
CG13138NP_609372.1 IMCp 188..279 CDD:289112 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.