DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32241 and T20B6.2

Sequence 1:NP_729000.2 Gene:CG32241 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_497635.1 Gene:T20B6.2 WormBaseID:WBGene00020598 Length:715 Species:Caenorhabditis elegans

Alignment Length:208 Identity:46/209 (22%)
Similarity:70/209 (33%) Gaps:60/209 (29%)


  Fly     8 ALVAVASADVSHLFSNSNNLQEDGYHYAPPSAPVVIDVPYV--PHESAPPRVVVYEAPKPKPTPP 70
            ||..:|..|:        |.::..:..||.|.. .:|:.:|  |..:.||           ||| 
 Worm   454 ALDVLAKMDL--------NFKKYNFQSAPASLQ-ALDLFFVNYPLHARPP-----------PTP- 497

  Fly    71 RPVYTPPVVIPSEPAGVLKDDGYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVIAPPPVYVPPPT 135
                    :.||..|..........|..|..   :..|...:..:      :|.|...||:    
 Worm   498 --------ITPSGSASAPGSGSATNGTNSAS---NDGPESSIALV------LVAAGVIVYI---- 541

  Fly   136 KKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP-------KKVVY 193
              ::...|.|...:|.:..|.|||       .|..|.|...||...|..|.||       |::|.
 Worm   542 --MMRKKPEPQNVEKPIPKPNPPP-------APAKPDPVPVVVAIDPVVPAPPEVVPEEVKELVV 597

  Fly   194 TPPPTGILKDDGY 206
            ....:.::.|..|
 Worm   598 EDTQSSLMSDTQY 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
T20B6.2NP_497635.1 WSN 78..146 CDD:197734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.