DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32241 and C54D2.1

Sequence 1:NP_729000.2 Gene:CG32241 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_509326.3 Gene:C54D2.1 WormBaseID:WBGene00016915 Length:388 Species:Caenorhabditis elegans

Alignment Length:275 Identity:58/276 (21%)
Similarity:76/276 (28%) Gaps:103/276 (37%)


  Fly    38 SAPVVIDVPYVPHESAPP--RVVVYEAPKPKPTPPRPVYTPPVVIPSEPAGVLKDDGYHYGQPSV 100
            ||..|..|..||...||.  |.|..:|    .|..||||.|.|..|.                .|
 Worm    73 SAAAVNGVYQVPAGVAPATFRTVYTDA----LTAVRPVYQPVVYYPQ----------------VV 117

  Fly   101 KFEVSAPPPPKVEY---LPPPTKKVVIAP-PPVYVPPPTKKVVYTPPPPPPTKKVVYTPPP---- 157
            :..::...||..|.   :|.||....:|| .|..:|.|..:...||.....:..:.|   |    
 Worm   118 RTPIACALPPCHEVPVPVPVPTAPATVAPTAPTDLPTPAPEATTTPRRLFDSPSIAY---PGDYC 179

  Fly   158 --------------------------------PPPTKKVVYTPPPPPPTKKVVYTPPPPPP---- 186
                                            |..|.....|.....||   .:.|..|.|    
 Worm   180 ETTNIICVGGSFCVNNVCVCREGEIIENRQCVPVATTTTTTTTTTAAPT---THRPLHPRPQLQQ 241

  Fly   187 -PPKKVVY--------------------------TPPPTGILKDDGYHYGQPSVKFEVSAPPAPK 224
             ||:..||                          |...|.:..........|:..|..:..|||.
 Worm   242 LPPRYFVYAMEIRTAAGRHASAATYLAYFVASAQTTTTTELATTTTTTTEAPTTTFSTTTTPAPT 306

  Fly   225 VEYLPPPTKKVVIAP 239
            ..::.|.|    :||
 Worm   307 TTFIIPTT----VAP 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
C54D2.1NP_509326.3 EB <171..210 CDD:279949 2/42 (5%)
EB 336..383 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.