DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and C54D2.1

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001360717.1 Gene:C54D2.1 / 183776 WormBaseID:WBGene00016915 Length:388 Species:Caenorhabditis elegans


Alignment Length:261 Identity:53/261 - (20%)
Similarity:66/261 - (25%) Gaps:75/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PVYVPPPTKKVVYT---PPPPPPTKKVVYTPPPPPPTKKVVYTP-------------PPPPPTKK 176
            |..|.|.|.:.|||   ....|..:.|||.|       :||.||             |.|.||..
 Worm    84 PAGVAPATFRTVYTDALTAVRPVYQPVVYYP-------QVVRTPIACALPPCHEVPVPVPVPTAP 141

  Fly   177 VVYTPPPP---PPPPKKVVYTPPPTGILKDDGYHYGQPSVKFE---------------------- 216
            ....|..|   |.|..:...||...         :..||:.:.                      
 Worm   142 ATVAPTAPTDLPTPAPEATTTPRRL---------FDSPSIAYPGDYCETTNIICVGGSFCVNNVC 197

  Fly   217 -------VSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPT 274
                   :.......|......|.....||..|....||.....|.|....|.....|.|.|...
 Worm   198 VCREGEIIENRQCVPVATTTTTTTTTTAAPTTVITTEPTTTTTTTEPTTTTTTTTTTTTPAPTTA 262

  Fly   275 KKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKKVYVA 339
            .....|.....      ..|...|.:..........|:..|..:..|||...::.|     ..||
 Worm   263 STTTTTTTTTE------AQTTTTTELATTTTTTTEAPTTTFSTTTTPAPTTTFIIP-----TTVA 316

  Fly   340 P 340
            |
 Worm   317 P 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
C54D2.1NP_001360717.1 EB <171..210 CDD:366756 1/38 (3%)
EB 336..383 CDD:366756
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.