DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32241 and F14F7.5

Sequence 1:NP_729000.2 Gene:CG32241 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001293623.1 Gene:F14F7.5 WormBaseID:WBGene00008812 Length:917 Species:Caenorhabditis elegans

Alignment Length:94 Identity:24/95 (25%)
Similarity:34/95 (36%) Gaps:26/95 (27%)


  Fly   101 KFEVSAPPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVV 165
            |:|.:..||...  :||.|        |:..|.|:.:...:.|.|.|...   :||.|       
 Worm   769 KYEATLFPPTTT--IPPAT--------PLSSPAPSNQSPPSQPQPGPRGS---SPPAP------- 813

  Fly   166 YTPPPPPPTKK-----VVYTPPPPPPPPK 189
             :.|..|.|..     |..|..|..|.|:
 Worm   814 -SAPSAPETDTNSLALVDLTDSPADPTPE 841

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
F14F7.5NP_001293623.1 WSN 55..123 CDD:197734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.