DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS4 and INTS4

DIOPT Version :8

Sequence 1:NP_572488.1 Gene:IntS4 / 31793 FlyBaseID:FBgn0026679 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_291025.3 Gene:INTS4 / 92105 HGNCID:25048 Length:963 Species:Homo sapiens

Alignment Length:1086 Identity:366/1086 - (33%)
Similarity:551/1086 - (50%) Gaps:189/1086 - (17%)


  Fly     1 MALAIKKRVGTYVETVDGSPP-----VKKLRLQTLAADAKGGKSGKVGNVERKLTALNQLDAYVG 60
            ||..:||||  |.|......|     .|||||      .|..||           |...:|....
Human     1 MAAHLKKRV--YEEFTKVVQPQEEIATKKLRL------TKPSKS-----------AALHIDLCKA 46

  Fly    61 NLPAGALVLPTGTPVASTGAPSTGVIGNPPAAATGAPPMTAANSRELLELLVKITDEISYEDVEM 125
            ..||.||                                     :.||:...|        .||.
Human    47 TSPADAL-------------------------------------QYLLQFARK--------PVEA 66

  Fly   126 GELKEVASKIFQLYQLQERDSDTSIRVKLLELL------SGLGCECATEQALTMIIDYFIFLLRK 184
            ..::.|...:.:.|.   :::|.|:|:|:..||      :|...:|        |:|..|.:|:.
Human    67 ESVEGVVRILLEHYY---KENDPSVRLKIASLLGLLSKTAGFSPDC--------IMDDAINILQN 120

  Fly   185 EVSQKVLAQGMMCLFRIGER-------RKHMLPISYK--TQVAHLAKEQ-------LRSGSAHTQ 233
            |.|.:||||.:..|..||.:       :..::.::.|  |..:|..:.:       |.|......
Human   121 EKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKSVT 185

  Fly   234 KNAMLVIGRFATKMEGERHYVWKLAFYIDSQDSSVRAQALHALLTLGERGSQLPAVLYKRAVEAM 298
            |:|..:..|...|:.|:         |...||..||..|:.|:|.|.|||.:|...:|.:|.:.:
Human   186 KDAEGLAARDVQKIIGD---------YFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKLL 241

  Fly   299 KDDYECVRKEALQLVFMLGNRHPDYILPSDRQQEELRMIDAAFSKVCEALCDLSLQIRVLAAELL 363
            .||||.||..|:||::::...:|:.|:|.....||:|::|.||.|:|..:.|.|..:||.||:||
Human   242 SDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRVQAAKLL 306

  Fly   364 GGMTAVSREFLHQTLDKKLMSNLRRKRTAHERGARLVASGEWSSGKRWADDAPQEHLDAQSISII 428
            |.|..||..||.|||||||||:||||||||||...|.:|||:|||::|.||||:|.:|..::::|
Human   307 GSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLI 371

  Fly   429 ASGACGALIHGLEDEFLEVRTAAVASMCKLALSRPDFAVTSLDFLVDMFNDEIEDVRLKAIYSLT 493
            .||||||.:||||||..|||.|||.::|.||.|.|.||...|||||||||||||:|||::|:::.
Human   372 ESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMFNDEIEEVRLQSIHTMR 436

  Fly   494 AIAKHIVLREDQLEIMLGSLEDYSVDVREGLHLMLGACRVSTQTCLLMVVQKLLDVLAKYPQDRN 558
            .|:.:|.||||||:.:|..|||.|.|:||.||.:|....|||:..:.:.:.:||..|.|||.||:
Human   437 KISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHLALVELLKNLTKYPTDRD 501

  Fly   559 STYACMRKIGQKHPHLVMAVAVHLLYVHPFFETPERDVEDPAYLCVLILVFNAAEHLVPIISLLP 623
            |.:.|::.:|.:||.||:.:...||..||||:|.|.|::||||:.||:|:||||:....:.:|..
Human   502 SIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPTMPALFS 566

  Fly   624 TATHRHYAYLRDSMPNLVPQLPIEG---ASSASATHRIDSAMHQAGSSAEYLQMILSHIEEIFTM 685
            ..|.|||||||||:.:|||.|.:.|   .|||.:    .|.:.|...|.::||..|..:..:..:
Human   567 DHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVS----PSIIPQEDPSQQFLQQSLERVYSLQHL 627

  Fly   686 TDE-RLELLQTAQSNLQRLGSIDAGMYGTSNFLETFLAAQ-IQIEQMQRCASTQRSRVPLKES-L 747
            ..: ..|||:....:|||||.:.:.:.|.::|..|:|..| :.|:.:|.......:.:.||:| |
Human   628 DPQGAQELLEFTIRDLQRLGELQSELAGVADFSATYLRCQLLLIKALQEKLWNVAAPLYLKQSDL 692

  Fly   748 AA-----LIRNCLKLQHTFSGLNYGDILQVKQLRLRACALHLVLVVR-DRSQSAL-GPCQMLLQT 805
            |:     ::....|::..:||:....::.:..:||:|.||.|::..| .|....| |.|:..||.
Human   693 ASAAAKQIMEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQE 757

  Fly   806 AGDISEFIKANTKDEEEKPPVVETDMPMKESVSRDAQPDSFTRQLLIKLDGISDPKPGRVFREIL 870
            ......:..|              |:|..:        |||..:||..:..:...||..|.:.:.
Human   758 VDFFQRYFIA--------------DLPHLQ--------DSFVDKLLDLMPRLMTSKPAEVVKILQ 800

  Fly   871 PLVQQAPPLALPPANDKIRRCVANILEPCPLQSQDNVIKVTAGLIAAVPFVAEIDNLLESQKADM 935
            .:::|:..|.| |..::|.:..|.|:||.  ...||.::.|:||:.|:...|.::::.:.|.. :
Human   801 TMLRQSAFLHL-PLPEQIHKASATIIEPA--GESDNPLRFTSGLVVALDVDATLEHVQDPQNT-V 861

  Fly   936 RIKIKYPDQHMHTVVPKQSDFK---PIMTEQGEHKTNVRLRTTILLSHSVWTESSLVEIQLCLAV 997
            ::::.|||.....:.||.:||:   |     |.|    ||.|.:.|||:.|||:..||::|.||.
Human   862 KVQVLYPDGQAQMIHPKPADFRNPGP-----GRH----RLITQVYLSHTAWTEACQVEVRLLLAY 917

  Fly   998 RPGSELELC-----------------------KPAKVLFAPKPVRR 1020
            ...:.:..|                       ||.||...|||.||
Human   918 NSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKPARR 963

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IntS4NP_572488.1 HEAT repeat 290..326 CDD:293787 13/35 (37%)
HEAT repeat 339..414 CDD:293787 45/74 (61%)
HEAT repeat 432..459 CDD:293787 17/26 (65%)
HEAT repeat 468..498 CDD:293787 18/29 (62%)
HEAT repeat 504..528 CDD:293787 13/23 (57%)
INTS4NP_291025.3 HEAT_2 51..>256 CDD:330925 63/269 (23%)
HEAT 1 66..105 8/41 (20%)
HEAT repeat 115..143 CDD:293787 11/27 (41%)
HEAT 2 145..183 5/37 (14%)
HEAT repeat 155..182 CDD:293787 5/26 (19%)
HEAT 3 190..228 15/46 (33%)
HEAT repeat 199..221 CDD:293787 8/30 (27%)
HEAT 4 229..263 12/33 (36%)
HEAT repeat 233..272 CDD:293787 14/38 (37%)
HEAT 5 277..313 16/35 (46%)
HEAT repeat 282..311 CDD:293787 14/28 (50%)
HEAT repeat 320..347 CDD:293787 20/26 (77%)
HEAT repeat 360..398 CDD:293787 21/37 (57%)
HEAT 6 369..405 22/35 (63%)
Adaptin_N <379..460 CDD:331138 48/80 (60%)
HEAT 7 406..444 22/37 (59%)
HEAT repeat 411..441 CDD:293787 18/29 (62%)
HEAT 8 446..484 18/37 (49%)
HEAT repeat 447..475 CDD:293787 14/27 (52%)
HEAT repeat 486..512 CDD:293787 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188317269
eggNOG 1 0.900 E1_KOG2259
Hieranoid 1 1.000
Homologene 1 1.000 H69427
Inparanoid 1 1.050 511 1.000 Inparanoid score I1301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D204348at33208
OrthoFinder 1 1.000 FOG0005615
OrthoInspector 1 1.000 T1075445
orthoMCL 1 0.900 OOG5_131816
Panther 1 1.100 LDO PTHR20938
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3511
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.