DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and SKP2A

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001321134.1 Gene:SKP2A / 838740 AraportID:AT1G21410 Length:360 Species:Arabidopsis thaliana

Alignment Length:411 Identity:78/412 (19%)
Similarity:130/412 (32%) Gaps:157/412 (38%)


  Fly    12 PSSLLFIFKLLSLEDQLHL---ARCCRIFRDAF------LRLH--RHDFQ----DVVDKDMSIRT 61
            |..||  .::|||.|..::   :..|..:|||.      |||.  .::..    .:|.|.:.::|
plant    32 PVELL--MRILSLVDDRNVIVASGVCTGWRDAISFGLTRLRLSWCNNNMNSLVLSLVPKFVKLQT 94

  Fly    62 LEDWRTFLWLCGSRIGTLESHFDDDHPLQL----LPMISRHCYRLKSISIYNATVARAQPYLLRM 122
            |                   :...|.| ||    :..|:.||:.|:.:.:               
plant    95 L-------------------NLRQDKP-QLEDNAVEAIANHCHELQELDL--------------- 124

  Fly   123 SSLEKVHVRNYKSTSKDLIKAIGIHLPRVNSLSLESFERKELQEVRQFSEMLELGLYDDVTASEF 187
                   .::.|.|.:.|. |:....|.:..|:|..        ...||:            :..
plant   125 -------SKSLKITDRSLY-ALAHGCPDLTKLNLSG--------CTSFSD------------TAI 161

  Fly   188 ATIVKPMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDC----DADLLVLPQFVNLKYL 248
            |.:.:..|||:.|.|....:.:|.:.|..:..||..::.|....|    |..::.|         
plant   162 AYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSL--------- 217

  Fly   249 QLYCSEDMKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQAQYISALKCLRWLVCKPRDDLCVHH 313
             .|...|::|       ...|...|          |.:|....::              |.||| 
plant   218 -AYGCPDLRT-------LDLCGCVL----------ITDESVVALA--------------DWCVH- 249

  Fly   314 LAKLSRLECLSIQSAREIGETQLSLLVA------------------NNERLRYLNICYCLGITDA 360
                  |..|.:...|.|.:..:..|..                  :.|.||.|||..|..:|.:
plant   250 ------LRSLGLYYCRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNISQCTALTPS 308

  Fly   361 ---FVLDTLASLSKRSAHQTL 378
               .|.|:..:|...|...:|
plant   309 AVQAVCDSFPALHTCSGRHSL 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 7/26 (27%)
leucine-rich repeat 224..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..272 CDD:275381 4/27 (15%)
leucine-rich repeat 273..297 CDD:275381 3/24 (13%)
leucine-rich repeat 298..319 CDD:275381 4/21 (19%)
leucine-rich repeat 320..345 CDD:275381 6/43 (14%)
leucine-rich repeat 346..372 CDD:275381 10/29 (34%)
SKP2ANP_001321134.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13318
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.