DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and AT5G27920

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_568502.1 Gene:AT5G27920 / 832858 AraportID:AT5G27920 Length:642 Species:Arabidopsis thaliana

Alignment Length:475 Identity:97/476 (20%)
Similarity:177/476 (37%) Gaps:136/476 (29%)


  Fly    14 SLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFLWLCGSRIGT 78
            :|||.:..||   .|.|:.|.::..|..|||    ..|.....:.|::|...|:    ...|...
plant    59 TLLFKYPNLS---SLDLSVCPKLDDDVVLRL----ALDGAISTLGIKSLNLSRS----TAVRARG 112

  Fly    79 LESHFDDDHPLQLLPMISRHCYRL--------------------KSISIYNATVARAQPYLLRMS 123
            ||:.....|.|:.:.:  .||:..                    |.:|:.:..:||   .::..|
plant   113 LETLARMCHALERVDV--SHCWGFGDREAAALSSATGLRELKMDKCLSLSDVGLAR---IVVGCS 172

  Fly   124 SLEKVHVR-------------------------NYKSTSKDLIKAIG----------IHLPRVNS 153
            :|.|:.::                         :|...:.|.|::|.          :..|.::.
plant   173 NLNKISLKWCMEISDLGIDLLCKICKGLKSLDVSYLKITNDSIRSIALLVKLEVLDMVSCPLIDD 237

  Fly   154 LSLESFER--KELQE--VRQFSEMLELGL------YDDV-----------TASEFATIVKPMRKL 197
            ..|:..|.  ..|||  |.:...:...||      :.|:           .:..|...:|.::.|
plant   238 GGLQFLENGSPSLQEVDVTRCDRVSLSGLISIVRGHPDIQLLKASHCVSEVSGSFLKYIKGLKHL 302

  Fly   198 RCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDC----DADLLVLPQ-FVNLKYLQLYCSEDMK 257
            :.:.:..|  .::.|:|..|:::||.|.::..:.|    |..::.|.: .:|||.|.|.|...:.
plant   303 KTIWIDGA--HVSDSSLVSLSSSCRSLMEIGLSRCVDVTDIGMISLARNCLNLKTLNLACCGFVT 365

  Fly   258 TRLFKALAKS----------QC--------------SIQLEYLILHRKRWIDEEQAQYISALKC- 297
            .....|:|:|          .|              |:.::.|.|.....:::...:|||  || 
plant   366 DVAISAVAQSCRNLGTLKLESCHLITEKGLQSLGCYSMLVQELDLTDCYGVNDRGLEYIS--KCS 428

  Fly   298 ----LRWLVCKPRDDLCVHHL-AKLSRLECLSIQSAREIGETQLSLLVANNERLRYLNICYCLGI 357
                |:..:|....|..:.|: :|.|:|..|.:......|:..|:.|....:.|..|.:.||..:
plant   429 NLQRLKLGLCTNISDKGIFHIGSKCSKLLELDLYRCAGFGDDGLAALSRGCKSLNRLILSYCCEL 493

  Fly   358 TDAFV-----LDTLASLSKR 372
            ||..|     |:.|:.|..|
plant   494 TDTGVEQIRQLELLSHLELR 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 7/26 (27%)
leucine-rich repeat 224..244 CDD:275381 4/25 (16%)
leucine-rich repeat 245..272 CDD:275381 10/51 (20%)
leucine-rich repeat 273..297 CDD:275381 6/24 (25%)
leucine-rich repeat 298..319 CDD:275381 6/22 (27%)
leucine-rich repeat 320..345 CDD:275381 5/25 (20%)
leucine-rich repeat 346..372 CDD:275381 10/31 (32%)
AT5G27920NP_568502.1 AMN1 65..261 CDD:187754 38/212 (18%)
leucine-rich repeat 67..96 CDD:275381 10/36 (28%)
leucine-rich repeat 97..122 CDD:275381 7/29 (24%)
leucine-rich repeat 123..147 CDD:275381 3/26 (12%)
leucine-rich repeat 148..173 CDD:275381 5/28 (18%)
leucine-rich repeat 174..199 CDD:275381 2/25 (8%)
AMN1 192..393 CDD:187754 37/203 (18%)
leucine-rich repeat 200..222 CDD:275381 4/22 (18%)
leucine-rich repeat 224..249 CDD:275381 3/25 (12%)
leucine-rich repeat 250..298 CDD:275381 9/48 (19%)
leucine-rich repeat 299..352 CDD:275381 11/55 (20%)
AMN1 <329..464 CDD:187754 29/137 (21%)
leucine-rich repeat 353..378 CDD:275381 8/25 (32%)
leucine-rich repeat 379..404 CDD:275381 2/25 (8%)
AMN1 405..>567 CDD:187754 29/112 (26%)
leucine-rich repeat 405..429 CDD:275381 7/26 (27%)
leucine-rich repeat 430..455 CDD:275381 6/25 (24%)
leucine-rich repeat 456..481 CDD:275381 5/25 (20%)
leucine-rich repeat 482..506 CDD:275381 8/24 (33%)
leucine-rich repeat 507..532 CDD:275381 3/8 (38%)
leucine-rich repeat 533..558 CDD:275381
leucine-rich repeat 559..583 CDD:275381
leucine-rich repeat 584..609 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13318
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.