DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and EBF1

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_565597.1 Gene:EBF1 / 817087 AraportID:AT2G25490 Length:628 Species:Arabidopsis thaliana

Alignment Length:455 Identity:95/456 (21%)
Similarity:154/456 (34%) Gaps:159/456 (35%)


  Fly     4 ITSILDLDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTF 68
            :::|.|   :.||.|.:..:..::|.|.||..|.....:.:.:.      ..:::..|||     
plant   187 VSTITD---NGLLEIAEGCAQLEKLELNRCSTITDKGLVAIAKS------CPNLTELTLE----- 237

  Fly    69 LWLCGSRIGTLESHFDDDHPLQLLPMISRHCYRLKSISIYNATVARAQP---------------- 117
              .| ||||      |:.     |..|:|.|.:|||:||.|..:.|.|.                
plant   238 --AC-SRIG------DEG-----LLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLK 288

  Fly   118 -YLLRMSSLEKVHVRNYKSTSKDLIKA--------------IGIHLPRVN--------------- 152
             .:|.::.:....|.:|..:..||:.|              .|:.|.::|               
plant   289 LQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGL 353

  Fly   153 --------------------------------SLSLESFERKELQEVRQ---FSEMLELGLYDDV 182
                                            ||||||.:.:|...|.|   |..:|..|     
plant   354 ESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCG----- 413

  Fly   183 TASEFATIVKPMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDCDADLLVLPQF--VNL 245
                  ..:|....:.||.:|:....|..|      ::|..|..|:..:|       |.|  .||
plant   414 ------EKLKAFSLVNCLSIRDLTTGLPAS------SHCSALRSLSIRNC-------PGFGDANL 459

  Fly   246 KYLQLYCSEDMKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQAQYI--SALKCLRWLVCKPRDD 308
            ..:...|.                  |||.:.|...:.|.|....::  |:|..:.:..|....|
plant   460 AAIGKLCP------------------QLEDIDLCGLKGITESGFLHLIQSSLVKINFSGCSNLTD 506

  Fly   309 LCVHHLAKLS--RLECLSIQSAREIGETQLSLLVANNERLRYLNICYCLGITDAFVLDTLASLSK 371
            ..:..:...:  .||.|:|.....|.:..|..:.||.:.|..|:|..| .|:|:.: ..|||..|
plant   507 RVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKC-AISDSGI-QALASSDK 569

  Fly   372  371
            plant   570  569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 6/26 (23%)
leucine-rich repeat 224..244 CDD:275381 5/22 (23%)
leucine-rich repeat 245..272 CDD:275381 2/27 (7%)
leucine-rich repeat 273..297 CDD:275381 7/26 (27%)
leucine-rich repeat 298..319 CDD:275381 2/23 (9%)
leucine-rich repeat 320..345 CDD:275381 8/25 (32%)
leucine-rich repeat 346..372 CDD:275381 10/27 (37%)
EBF1NP_565597.1 F-box-like 64..103 CDD:289689
AMN1 <149..298 CDD:187754 32/139 (23%)
leucine-rich repeat 179..204 CDD:275381 5/20 (25%)
leucine-rich repeat 205..230 CDD:275381 5/31 (16%)
leucine-rich repeat 231..256 CDD:275381 13/44 (30%)
leucine-rich repeat 257..283 CDD:275381 8/26 (31%)
leucine-rich repeat 284..308 CDD:275381 3/24 (13%)
leucine-rich repeat 309..336 CDD:275381 5/27 (19%)
leucine-rich repeat 337..362 CDD:275381 1/25 (4%)
leucine-rich repeat 363..388 CDD:275381 2/25 (8%)
leucine-rich repeat 416..442 CDD:275381 7/32 (22%)
AMN1 440..611 CDD:187754 37/158 (23%)
leucine-rich repeat 443..468 CDD:275381 8/50 (16%)
leucine-rich repeat 469..492 CDD:275381 6/23 (26%)
leucine-rich repeat 493..519 CDD:275381 3/26 (12%)
leucine-rich repeat 520..545 CDD:275381 8/25 (32%)
leucine-rich repeat 546..571 CDD:275381 10/27 (37%)
leucine-rich repeat 572..591 CDD:275381
leucine-rich repeat 598..619 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13318
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.