DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbxl7

DIOPT Version :10

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster


Alignment Length:131 Identity:27/131 - (20%)
Similarity:59/131 - (45%) Gaps:37/131 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 EAIYYRHFKPVILWRLQNWIGIGLERKMRTALATVNRMFAKIISSRRKEEISRAKTEPYSKDAL- 277
            ||:.:  :.|.|:|||.:|.. |:..:....:|..:|:..  :.||.:              || 
  Fly   112 EALLF--YVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLD--LESRNR--------------ALQ 157

  Fly   278 TYYMNVDTS---KYKLLKPNKDKFIRDVIFSLVLAGRDTTSSVLTWFFWLLSKHPQVMAKLRHEI 339
            |...||:.:   |::::..|:.|     :.:|::..|.:.::| |:.:        :..|:.:.:
  Fly   158 TIATNVEEALHVKHQVMSGNRLK-----LLNLIICTRSSGAAV-TFLY--------ISVKILYTV 208

  Fly   340 N 340
            |
  Fly   209 N 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 2/8 (25%)
leucine-rich repeat 224..244 CDD:275381 6/19 (32%)
leucine-rich repeat 245..272 CDD:275381 4/26 (15%)
leucine-rich repeat 273..297 CDD:275381 7/27 (26%)
leucine-rich repeat 298..319 CDD:275381 3/20 (15%)
leucine-rich repeat 320..345 CDD:275381 2/21 (10%)
leucine-rich repeat 346..372 CDD:275381
Fbxl7NP_650512.1 leucine-rich repeat 502..521 CDD:275381
leucine-rich repeat 528..555 CDD:275381
leucine-rich repeat 556..581 CDD:275381
AMN1 577..746 CDD:187754
leucine-rich repeat 582..607 CDD:275381
leucine-rich repeat 608..633 CDD:275381
leucine-rich repeat 634..659 CDD:275381
leucine-rich repeat 660..685 CDD:275381
leucine-rich repeat 686..710 CDD:275381
leucine-rich repeat 711..735 CDD:275381
leucine-rich repeat 737..761 CDD:275381
dermokine <279..>394 CDD:455732
F-box_SF 401..444 CDD:459239
leucine-rich repeat 441..460 CDD:275381
leucine-rich repeat 476..501 CDD:275381
LRR <483..>640 CDD:443914
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.