DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbxl7

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster

Alignment Length:423 Identity:94/424 (22%)
Similarity:152/424 (36%) Gaps:114/424 (27%)


  Fly    10 LDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFLWLCGS 74
            |...:::.||..|...:..::||.||.|...                       .||..||...|
  Fly   404 LPDEAVVRIFSWLDSCELCNVARVCRRFEHL-----------------------AWRPILWKVIS 445

  Fly    75 RIGTLESHFDDDHPLQLL--PMISRHCYRLKSISIYNATVARAQPYLLRMSSLEKVHVRNYKSTS 137
            ..|   .|.:.|..|:::  .:..:.|         |......:..:|                 
  Fly   446 LRG---EHLNGDKTLKMIFRQLCGQSC---------NGACPEVERVML----------------- 481

  Fly   138 KDLIKAIGIHLPRVNSLSLESFERK--ELQEVRQFSEMLELGLYDDVTASEFATIVKPMRKLRCL 200
                 |.|.   |::...|:...|:  ||..       |:|....|:|..   .:|:.:.|  | 
  Fly   482 -----ADGC---RISDKGLQLLTRRCPELTH-------LQLQTCVDITNQ---ALVEALTK--C- 525

  Fly   201 QLRNAKRFLTTSNLRML-ATNCRHLEKLTFNDCDADLLVLPQFVNLKYLQL---YCSEDMKTRLF 261
                       |||:.| .|.|..:..::.|    ..:..|:.:.|:||.|   ...:||.   .
  Fly   526 -----------SNLQHLDVTGCSQVSSISPN----PHMEPPRRLLLQYLDLTDCMAIDDMG---L 572

  Fly   262 KALAKSQCSIQLEYLILHRKRWIDEEQAQYIS----ALKCLRWLVCKPRDDLCVHHLAKL-SRLE 321
            |.:.|: |. ||.||.|.|...:.:...:::.    :||.|....|....|..::.|||| :.|.
  Fly   573 KIVVKN-CP-QLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALR 635

  Fly   322 CLSIQSAREIGETQLSLLVANNERLRYLNICYCLGITDAFVLDTLASLSKRSAHQTLELFAAATD 386
            .||:.....:.:..|.::.....:|||||...|..::|    |::..|: ||..:...|.....|
  Fly   636 YLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSD----DSITVLA-RSCPRLRALDIGKCD 695

  Fly   387 IRHDIMERLPHEFP-LKMLCLNFECSDGMTSGG 418
            :....:..|....| ||.|.|. .| |.:|..|
  Fly   696 VSDAGLRALAESCPNLKKLSLR-SC-DMITDRG 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 7/27 (26%)
leucine-rich repeat 224..244 CDD:275381 2/20 (10%)
leucine-rich repeat 245..272 CDD:275381 9/30 (30%)
leucine-rich repeat 273..297 CDD:275381 7/28 (25%)
leucine-rich repeat 298..319 CDD:275381 7/22 (32%)
leucine-rich repeat 320..345 CDD:275381 4/25 (16%)
leucine-rich repeat 346..372 CDD:275381 9/26 (35%)
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 14/66 (21%)
leucine-rich repeat 441..460 CDD:275381 6/22 (27%)
AMN1 <451..595 CDD:187754 42/211 (20%)
leucine-rich repeat 476..501 CDD:275381 6/50 (12%)
leucine-rich repeat 502..521 CDD:275381 6/29 (21%)
leucine-rich repeat 528..555 CDD:275381 6/31 (19%)
leucine-rich repeat 556..581 CDD:275381 9/30 (30%)
AMN1 577..746 CDD:187754 44/160 (28%)
leucine-rich repeat 582..607 CDD:275381 5/25 (20%)
leucine-rich repeat 608..633 CDD:275381 9/25 (36%)
leucine-rich repeat 634..659 CDD:275381 4/25 (16%)
leucine-rich repeat 660..685 CDD:275381 11/30 (37%)
leucine-rich repeat 686..710 CDD:275381 4/24 (17%)
leucine-rich repeat 711..735 CDD:275381 8/19 (42%)
leucine-rich repeat 737..761 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13318
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.