DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and CG32085

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster

Alignment Length:471 Identity:95/472 (20%)
Similarity:159/472 (34%) Gaps:156/472 (33%)


  Fly     8 LDLDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRH-----------DFQDVVDKDMS--- 58
            |.||...|...|:..|..::..||:.|..:||...|..|:           :.:.:...|..   
  Fly   283 LMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLY 347

  Fly    59 ---IRTLEDWRTF--LWLCGSRIGTLESHFDDDHPLQLL---PMISRHCY----RLKSI------ 105
               ||     |.|  |.|.|:         .|:..|.::   |:.|:|.:    |..||      
  Fly   348 NSLIR-----RGFHALGLVGA---------SDEDALDVVHSFPLASKHVHSLSLRCSSISDRGLE 398

  Fly   106 -------SIYNATVARAQ------------PYLLRMSSLEKVHVRNYKSTSKDLIKAIGIHLPRV 151
                   |::...:|...            |.::.:|..:.:::      :.:.:.|:...||.:
  Fly   399 TLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINI------ADEAVGAVAQLLPSL 457

  Fly   152 NSLSLES----------FERKELQEVRQFSEMLELGLYDDVTASEFATIVKPMRKLRCLQLRNAK 206
            ...||::          |..|:...:    .:|.|....::|......||..:..|..|.|....
  Fly   458 YEFSLQAYHVTDAALGYFSPKQSHSL----SILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCS 518

  Fly   207 RFLTTSNLRMLATNCRHLEKLTFNDCDADLLVLPQF--VNLKYLQLYCSEDMKTRLFKALAKSQC 269
            : ||...:.::|.|.:.|..|..:.|       |:.  .:|:|:                   .|
  Fly   519 K-LTDDGVELIAENLQKLRALDLSWC-------PRITDASLEYI-------------------AC 556

  Fly   270 SI-QLEYLILHRKRWIDEEQAQYISALKC-----LRWLVCKPRDDLCVHHLAKLSRLECLSIQSA 328
            .: |||.|.|.|...|.:....|||.:..     |||  |....|..:.||..:..|:.||:...
  Fly   557 DLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRW--CSQVRDFGLQHLCSMRNLQVLSLAGC 619

  Fly   329 REIGETQLSLLVANNERLRYLNICYCLGITDAFVLDTLASLSKRSAHQTLELFAAATDIRHDIME 393
            ..:..:.||.|:    :||:|                          |.||| .......|::.:
  Fly   620 PLLTSSGLSSLI----QLRHL--------------------------QELEL-TNCPGASHELFD 653

  Fly   394 RLPHEFPLKMLCLNFE 409
            .|....|   .||..|
  Fly   654 YLKEHLP---RCLIIE 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 7/26 (27%)
leucine-rich repeat 224..244 CDD:275381 4/22 (18%)
leucine-rich repeat 245..272 CDD:275381 3/28 (11%)
leucine-rich repeat 273..297 CDD:275381 9/24 (38%)
leucine-rich repeat 298..319 CDD:275381 7/21 (33%)
leucine-rich repeat 320..345 CDD:275381 6/25 (24%)
leucine-rich repeat 346..372 CDD:275381 3/26 (12%)
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 3/24 (13%)
AMN1 383..600 CDD:187754 48/256 (19%)
leucine-rich repeat 431..456 CDD:275381 4/31 (13%)
leucine-rich repeat 457..482 CDD:275381 4/25 (16%)
leucine-rich repeat 483..508 CDD:275381 5/29 (17%)
leucine-rich repeat 509..534 CDD:275381 7/26 (27%)
leucine-rich repeat 535..560 CDD:275381 7/51 (14%)
leucine-rich repeat 561..585 CDD:275381 9/24 (38%)
leucine-rich repeat 586..610 CDD:275381 7/26 (27%)
leucine-rich repeat 636..661 CDD:275381 8/55 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13318
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.