DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and CG9003

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster

Alignment Length:440 Identity:96/441 (22%)
Similarity:162/441 (37%) Gaps:105/441 (24%)


  Fly     7 ILDLDPSSLLFIFKLLSLEDQLHLARCCRIFR---------DAFLRLHRHDFQDVVDKDMSIRTL 62
            |..|....||.:|..|   |.:.|.||.::.:         .::.:::..|||..::..:.....
  Fly   240 IKQLPKEVLLRVFSYL---DVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIENIS 301

  Fly    63 EDWRTFLWLCGSR---------IGTLESHFDDDHPLQL----------LPMISRHCYRLKSISIY 108
            :..|.||.....|         :.||.:|..:...|.|          ...|||:|.:|.:|:::
  Fly   302 QRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLH 366

  Fly   109 NAT---------VARAQPYLLRMSSLEKVHVRNYKSTSKDLIKAIGIHLPRVNSLSLESFERKEL 164
            :.:         ::...|.|:.: ::...|          ||...|:.......:.|..|..|..
  Fly   367 SCSNITDNSLKYLSDGCPNLMEI-NVSWCH----------LISENGVEALARGCVKLRKFSSKGC 420

  Fly   165 QEVRQFSEMLELGLYDDVTASEFATIVKPMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTF 229
            :::...:.|               .:.|....|..|.|.:.:. :|.|::|.||.||..|:||..
  Fly   421 KQINDNAIM---------------CLAKYCPDLMVLNLHSCET-ITDSSIRQLAANCHKLQKLCV 469

  Fly   230 NDC----DADLLVLPQFVN-LKYLQLYCSEDMKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQA 289
            :.|    |..||.|.|..: |..|::....:.....|:||.:: |    :||     ..:|.|: 
  Fly   470 SKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRN-C----KYL-----ERMDLEE- 523

  Fly   290 QYISALKCLRWLVCKPRDDLCVHHLAK-LSRLECLSIQSAREIGETQLSLLVANN---ERLRYLN 350
                         |....||.:.|||. ...||.|::.....|.:..:..|...:   |.|..|.
  Fly   524 -------------CSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLE 575

  Fly   351 ICYCLGITDAFVLDTLASLSKRSAHQTLELFAAATDIRHDIMERLPHEFP 400
            :..|..|||.    ||..|......|.:|||.... |....:.:|.:..|
  Fly   576 LDNCPLITDR----TLEHLVSCHNLQRIELFDCQL-ITRTAIRKLKNHLP 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 10/26 (38%)
leucine-rich repeat 224..244 CDD:275381 9/24 (38%)
leucine-rich repeat 245..272 CDD:275381 6/27 (22%)
leucine-rich repeat 273..297 CDD:275381 4/24 (17%)
leucine-rich repeat 298..319 CDD:275381 6/22 (27%)
leucine-rich repeat 320..345 CDD:275381 6/28 (21%)
leucine-rich repeat 346..372 CDD:275381 9/26 (35%)
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 10/48 (21%)
leucine-rich repeat 280..307 CDD:275381 4/27 (15%)
AMN1 <308..453 CDD:187754 29/172 (17%)
leucine-rich repeat 308..327 CDD:275381 3/19 (16%)
leucine-rich repeat 334..359 CDD:275381 6/25 (24%)
leucine-rich repeat 360..385 CDD:275381 3/25 (12%)
leucine-rich repeat 386..411 CDD:275381 5/36 (14%)
AMN1 <409..586 CDD:187754 52/221 (24%)
leucine-rich repeat 412..437 CDD:275381 5/40 (13%)
leucine-rich repeat 438..463 CDD:275381 10/26 (38%)
leucine-rich repeat 464..515 CDD:275381 15/56 (27%)
leucine-rich repeat 516..541 CDD:275381 9/44 (20%)
leucine-rich repeat 542..561 CDD:275381 4/19 (21%)
leucine-rich repeat 571..595 CDD:275381 9/28 (32%)
leucine-rich repeat 596..621 CDD:275381 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13318
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.