DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbl6

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster

Alignment Length:359 Identity:71/360 (20%)
Similarity:133/360 (37%) Gaps:100/360 (28%)


  Fly    21 LLSLEDQLHLARCCRIFRDAFLRLHRHDFQDV-VDKDMS------------IRTLEDWRTFLWLC 72
            |..|.|.:|             :|.|.|...: |:.:.|            ::|:....|.|:|.
  Fly   408 LTYLVDNMH-------------KLQRLDLSSINVEMNASKSAVGVNSLCNALQTMGSRLTHLYLA 459

  Fly    73 GSRIGTLESHFDDDHPLQLLPMISRHCYRLKSISIYNATVARAQPYLLRMSSLEKVHVRNYKSTS 137
            .:|:..:.         |::.::|.||..|..:.:.|.|.......:|.:..|::      ....
  Fly   460 HNRLAGIP---------QIVGILSTHCPNLTLLDLSNVTTQATSHGVLHIEKLQR------GCQK 509

  Fly   138 KDLIKAIGIHL-PRVNSLSLESFERKELQEVRQFSEMLEL---GLYDD---VTASEFATIVKPMR 195
            ..:::....|: |...|:       :|:.:...|.|:.||   .|.|:   ::......|:|...
  Fly   510 LKVLRVTNSHITPSTASM-------QEIMDSPGFPELEELSVAALTDESRIISDDHLQRILKSSS 567

  Fly   196 KLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDCDADLLVLPQFVNLKYLQLYCSEDMKTRL 260
            ||:.|.:||..|....|.:|:.|.:.:|   |..:.|..                  :.||.:.|
  Fly   568 KLKLLDVRNCTRLTHESLIRLPAWDIKH---LFLSGCSV------------------TRDMGSGL 611

  Fly   261 FKALAK-SQCSIQLEYLILHRKRWIDEEQAQYISALKCLRWLVCKPRDDLCVH-HLAKLSRLECL 323
            ....:| :...|:|:....:.::.||          ..||.|..|.||....| :|...|    :
  Fly   612 ELIASKWAHSLIELDLAWANMQQPID----------NALRALAEKGRDSPLAHLNLCGSS----V 662

  Fly   324 SIQSAREIGETQLSLLVANNERLRYLNICYCLGI 357
            |.::.:||        :.|.:.:..:|:..|.|:
  Fly   663 SDEAVKEI--------LTNCQNMSSINLASCRGL 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 8/26 (31%)
leucine-rich repeat 224..244 CDD:275381 2/20 (10%)
leucine-rich repeat 245..272 CDD:275381 5/28 (18%)
leucine-rich repeat 273..297 CDD:275381 3/24 (13%)
leucine-rich repeat 298..319 CDD:275381 9/22 (41%)
leucine-rich repeat 320..345 CDD:275381 4/25 (16%)
leucine-rich repeat 346..372 CDD:275381 3/13 (23%)
Fbl6NP_610665.2 F-box-like 293..341 CDD:289689
leucine-rich repeat 365..391 CDD:275381
leucine-rich repeat 392..417 CDD:275381 4/22 (18%)
leucine-rich repeat 418..445 CDD:275381 5/27 (19%)
leucine-rich repeat 453..471 CDD:275381 5/27 (19%)
leucine-rich repeat 480..509 CDD:275381 5/35 (14%)
leucine-rich repeat 510..538 CDD:275381 5/35 (14%)
leucine-rich repeat 539..579 CDD:275381 11/40 (28%)
leucine-rich repeat 580..621 CDD:275381 10/62 (16%)
leucine-rich repeat 622..649 CDD:275381 9/37 (24%)
leucine-rich repeat 652..676 CDD:275381 7/36 (19%)
leucine-rich repeat 677..698 CDD:275381 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13318
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.