DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and EEED8.10

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001040757.1 Gene:EEED8.10 / 173919 WormBaseID:WBGene00017138 Length:738 Species:Caenorhabditis elegans

Alignment Length:489 Identity:99/490 (20%)
Similarity:179/490 (37%) Gaps:118/490 (24%)


  Fly    18 IFKLLSLEDQLHLARCCRIFRDAFLR---------LHRHDFQDVVDKDMSIRTLEDWRTFLWLCG 73
            :...|.:.:.:.|.|..:.|.:..::         |.|   :.|.:|...:|| ...:..|...|
 Worm   253 VISFLPIHETIRLERVNKKFMEESIKSWELVNKIALAR---ETVFNKQRPMRT-SHLKAILTRAG 313

  Fly    74 SRIGTLE----SHFDDDHPLQLLPMISRHCYRLKSISIYNATVARAQPYLLR-----MSSLEKVH 129
            :.:.:|:    .|..||.  :.|.:|:..|..|..:.| :.|.|:|:  .|.     :|.||::.
 Worm   314 AHLRSLDVSGIVHLLDDR--RALKVIATCCPNLVDLDI-SGTHAQAE--ALEELGESLSHLEQLS 373

  Fly   130 VRNYKSTSKD----LIKAIGIHLPRVNSLSLESFERKELQEVRQFSEMLELGLY-------DDVT 183
            .|..::|...    |:|..|..|..|:   |.:.:|...:..:.|...|| .||       |::.
 Worm   374 YRGMETTGDKAFYFLLKNCGHSLKFVD---LRNSKRLHGRSFKLFGSQLE-SLYLDGSSKVDEMA 434

  Fly   184 ASEFATIVKPMRKLR---CLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDC--------DADLL 237
            ..:..|....:::||   |.:       :|..||.|:|.....|..||.  |        .|.|:
 Worm   435 FEDLCTSCGGLKELRINECYK-------ITDENLSMIARRMEDLSILTL--CGDGFKSLTSAGLI 490

  Fly   238 VLPQFVNLKYLQLYCSEDMKTRLFKALAKSQCSIQ-------LEYLILHRKRWIDEEQAQYISAL 295
            .:....|:..|.|.         :.||...:..|.       |..|.|..........|:.:||:
 Worm   491 HISHMRNITELALD---------YNALVNDELLISISAGLPLLSSLSLANAGNDSSITAEGVSAI 546

  Fly   296 KCLRWLVCKPRDDLC------VHHLAKLSRLECLSIQSAREIGETQL----------------SL 338
            |.|:.|.......|.      :..|..|.:||.:.:::...:|:..:                |:
 Worm   547 KNLKELTQLDASSLAAVNSKVLEQLGSLKKLEIIQLRNCTYLGDDGVRAKLRMPNIRHVDLSGSI 611

  Fly   339 LVANNERLRYLN----------ICYCLGITDAFVLDTLASLSKRSAHQTLELFAAATDIRHDIME 393
            ||:|:...:::.          |...:|.|.|    ..:.||.|.:...::....:|.:.....:
 Worm   612 LVSNDSIQQFIKAFPSGPKLPPITLVVGGTAA----DASKLSVRGSRVVVDFSDYSTIVTMQTSQ 672

  Fly   394 RLPHEFPLKMLCLNFECSD----GMTSGGHFYAD 423
            ....:|.:.....:.|.||    .:|:...||.|
 Worm   673 CSSSKFAIGGSASDAEGSDDEFEALTAQRSFYID 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 8/29 (28%)
leucine-rich repeat 224..244 CDD:275381 6/28 (21%)
leucine-rich repeat 245..272 CDD:275381 5/27 (19%)
leucine-rich repeat 273..297 CDD:275381 7/24 (29%)
leucine-rich repeat 298..319 CDD:275381 5/27 (19%)
leucine-rich repeat 320..345 CDD:275381 7/41 (17%)
leucine-rich repeat 346..372 CDD:275381 6/36 (17%)
EEED8.10NP_001040757.1 RRM <101..273 CDD:223796 4/20 (20%)
RRM_SF 114..197 CDD:240668
AMN1 <313..>464 CDD:187754 40/167 (24%)
leucine-rich repeat 316..337 CDD:275381 5/23 (22%)
leucine-rich repeat 344..368 CDD:275381 7/27 (26%)
leucine-rich repeat 369..395 CDD:275381 7/26 (27%)
AMN1 394..615 CDD:187754 49/243 (20%)
leucine-rich repeat 396..418 CDD:275381 5/25 (20%)
leucine-rich repeat 419..444 CDD:275381 6/26 (23%)
leucine-rich repeat 445..470 CDD:275381 8/32 (25%)
leucine-rich repeat 471..497 CDD:275381 6/28 (21%)
leucine-rich repeat 498..520 CDD:275381 5/31 (16%)
leucine-rich repeat 524..551 CDD:275381 8/27 (30%)
leucine-rich repeat 552..576 CDD:275381 4/24 (17%)
leucine-rich repeat 577..601 CDD:275381 3/24 (13%)
leucine-rich repeat 602..627 CDD:275381 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.